[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51203.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:113 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   29->67 PF06440 * DNA_pol3_theta 0.00046 32.4 37/75  
:HMM:PFM   58->102 PF09218 * DUF1959 0.00052 27.3 44/117  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51203.1 GT:GENE ABO51203.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 2923151..2923492 GB:FROM 2923151 GB:TO 2923492 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO51203.1 GB:DB_XREF GI:134053232 LENGTH 113 SQ:AASEQ MSNDNTQLPTLEQYILVALMDICRGLKVNLPVDLDKETQNTVLKDVLSSAISYAENQESMQVISEELFRCSREGCTLQDQMELIQKQSPDVINAKMVAAAYLLKLINKEQNLV GT:EXON 1|1-113:0| HM:PFM:NREP 2 HM:PFM:REP 29->67|PF06440|0.00046|32.4|37/75|DNA_pol3_theta| HM:PFM:REP 58->102|PF09218|0.00052|27.3|44/117|DUF1959| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,113-114| PSIPRED cccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccc //