[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51216.1
DDBJ      :             precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit
Swiss-Prot:             

Homologs  Archaea  38/68 : Bacteria  295/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:202 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->198 3e05G PDBj 6e-36 37.6 %
:RPS:PDB   7->198 3e05B PDBj 7e-23 34.7 %
:RPS:SCOP  13->194 1f38A  c.66.1.22 * 3e-41 35.8 %
:HMM:SCOP  26->162 1i9gA_ c.66.1.13 * 1e-26 31.9 %
:RPS:PFM   43->146 PF05175 * MTS 7e-07 39.6 %
:HMM:PFM   43->168 PF06325 * PrmA 1e-08 30.0 120/295  
:BLT:SWISS 11->199 CBIT_SULTO 6e-36 42.8 %
:PROS 47->76|PS01131|RRNA_A_DIMETH

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51216.1 GT:GENE ABO51216.1 GT:PRODUCT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2938902..2939510) GB:FROM 2938902 GB:TO 2939510 GB:DIRECTION - GB:PRODUCT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit GB:NOTE TIGRFAM: precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit PFAM: Methyltransferase type 12 KEGG: mta:Moth_1090 SAM (and some other nucleotide) binding protein GB:PROTEIN_ID ABO51216.1 GB:DB_XREF GI:134053245 InterPro:IPR001737 InterPro:IPR013217 InterPro:IPR014008 LENGTH 202 SQ:AASEQ MSKLEWPYTTPGIPDHLFKQSNAIPMTKQEIRLIAIGKMKLFPGAVVYDVGAGSGSVTVECALQIKNGTVYALEKDSSADELVEANARRFGLTNVRLVPGFAPDTMEKLPPADRIFIGGSAGALSEILETSHHKLKPDGWLVASAITLETGPRVLQFLEDKGYQQIEAVNISVARARQVARSHMWQGMNPVMIVSGQKPGKP GT:EXON 1|1-202:0| BL:SWS:NREP 1 BL:SWS:REP 11->199|CBIT_SULTO|6e-36|42.8|187/192| PROS 47->76|PS01131|RRNA_A_DIMETH|PDOC00871| BL:PDB:NREP 1 BL:PDB:REP 8->198|3e05G|6e-36|37.6|189/189| RP:PDB:NREP 1 RP:PDB:REP 7->198|3e05B|7e-23|34.7|190/192| RP:PFM:NREP 1 RP:PFM:REP 43->146|PF05175|7e-07|39.6|101/154|MTS| HM:PFM:NREP 1 HM:PFM:REP 43->168|PF06325|1e-08|30.0|120/295|PrmA| GO:PFM:NREP 1 GO:PFM GO:0008168|"GO:methyltransferase activity"|PF05175|IPR007848| RP:SCP:NREP 1 RP:SCP:REP 13->194|1f38A|3e-41|35.8|179/186|c.66.1.22| HM:SCP:REP 26->162|1i9gA_|1e-26|31.9|135/0|c.66.1.13|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 356 OP:NHOMOORG 335 OP:PATTERN ------1111111111--1-1-11-------111111111111-1111-1111---------11--11 ----1-1-----1-11-----1---1-1----1111-111-111-----------------11-112-111----------11-----11-1-111---------1-------------------11-1-----1111111-----2222221222211111212222222--1------------11----1-------------------------111----1111111----------------------------------11---------------------------------------------1----------111111111111111111111111----111-11111--1111----11------------11111---1111111111111111-1111111--1--11111111111111---111----11111111111----11-1-------------------------------1--------111111111111111111111111----------21--111-1---------------------11-11-1-11111111-111111111-----1-1-----------------------------1-------------------------1------1-------1---1--------------------------------111--11-1111111111111111----------1------------------------1-1-1---------------------------1111111111111-111---------------------1------------------1---1111--------1------------------------------11-------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 200 STR:RPRED 99.0 SQ:SECSTR #ccTHTccccccccGGGccccTTTcccHHHHHHHHHHHTTccTTcEEEEETcTTcHHHHHHHHHcTTcEEEEEEccHHHHHHHHHHHHHHTcTTEEEEEccTTTTcTTcccccEEEEcccTTcHHHHHHHHHHHccTTcEEEEEEccHHHHHHHHHHHHHTTcEEEEEEEEccEEccccccccccEEcccEEEEEEEcccc# DISOP:02AL 1-4,201-203| PSIPRED ccccccccccccccHHHHHccccccccHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHcccccEEEEEccHHHHccccccccEEEEccccccHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHcccEEEEEEEEEEEEEEEEcccccccccccEEEEEEEEcccc //