[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51225.1
DDBJ      :             iron dependent repressor
Swiss-Prot:             

Homologs  Archaea  37/68 : Bacteria  216/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.76.1
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->121 2hygD PDBj 4e-22 37.8 %
:RPS:PDB   2->115 1bi2B PDBj 1e-09 21.1 %
:RPS:SCOP  3->53 1on1A1  a.4.5.24 * 1e-11 43.1 %
:RPS:SCOP  63->123 1on1A2  a.76.1.1 * 4e-10 32.8 %
:HMM:SCOP  2->62 1on2A1 a.4.5.24 * 1.3e-13 32.8 %
:HMM:SCOP  63->135 1on2A2 a.76.1.1 * 1.9e-12 28.8 %
:RPS:PFM   2->60 PF01325 * Fe_dep_repress 9e-09 45.8 %
:RPS:PFM   63->123 PF02742 * Fe_dep_repr_C 3e-05 37.7 %
:HMM:PFM   1->58 PF01325 * Fe_dep_repress 7.9e-18 39.7 58/60  
:HMM:PFM   63->123 PF02742 * Fe_dep_repr_C 2.3e-11 36.1 61/71  
:BLT:SWISS 1->123 MNTR_BACHD 6e-24 42.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51225.1 GT:GENE ABO51225.1 GT:PRODUCT iron dependent repressor GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2948035..2948469) GB:FROM 2948035 GB:TO 2948469 GB:DIRECTION - GB:PRODUCT iron dependent repressor GB:NOTE PFAM: regulatory protein, MarR; iron dependent repressor KEGG: dsy:DSY2614 hypothetical protein GB:PROTEIN_ID ABO51225.1 GB:DB_XREF GI:134053254 InterPro:IPR000835 InterPro:IPR001367 LENGTH 144 SQ:AASEQ MLSPSLEDYLEEIYRISQSGETVRVTDIAACLNVSLPSVTRALQKLDESNHIMYRRYKDIILTEEGKKLGHFLVERNRIIREFLKLIGSKCDVAAEAEAMEHYLSMPTLKAIINFVNFSEKYPLWLDKYKGFCCNEEDKGENRV GT:EXON 1|1-144:0| BL:SWS:NREP 1 BL:SWS:REP 1->123|MNTR_BACHD|6e-24|42.3|123/139| BL:PDB:NREP 1 BL:PDB:REP 3->121|2hygD|4e-22|37.8|119/133| RP:PDB:NREP 1 RP:PDB:REP 2->115|1bi2B|1e-09|21.1|114/138| RP:PFM:NREP 2 RP:PFM:REP 2->60|PF01325|9e-09|45.8|59/59|Fe_dep_repress| RP:PFM:REP 63->123|PF02742|3e-05|37.7|61/68|Fe_dep_repr_C| HM:PFM:NREP 2 HM:PFM:REP 1->58|PF01325|7.9e-18|39.7|58/60|Fe_dep_repress| HM:PFM:REP 63->123|PF02742|2.3e-11|36.1|61/71|Fe_dep_repr_C| GO:PFM:NREP 6 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01325|IPR001367| GO:PFM GO:0005506|"GO:iron ion binding"|PF01325|IPR001367| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01325|IPR001367| GO:PFM GO:0003700|"GO:transcription factor activity"|PF02742|IPR001367| GO:PFM GO:0005506|"GO:iron ion binding"|PF02742|IPR001367| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF02742|IPR001367| RP:SCP:NREP 2 RP:SCP:REP 3->53|1on1A1|1e-11|43.1|51/56|a.4.5.24| RP:SCP:REP 63->123|1on1A2|4e-10|32.8|61/74|a.76.1.1| HM:SCP:REP 2->62|1on2A1|1.3e-13|32.8|61/0|a.4.5.24|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 63->135|1on2A2|1.9e-12|28.8|73/74|a.76.1.1|1/1|Iron-dependent repressor protein, dimerization domain| OP:NHOMO 283 OP:NHOMOORG 253 OP:PATTERN --1-1-----------1------1-----2-11121111111112113-221111111111---1-24 -----1-------------------------------------------------2---------11---1-------111-1----------------1-1--------------------------------1----1---1----------------------------------------------12111111111111111111111111111111111111111111-------------------1------------11--11------1-------------------------------------------1-1-14222----1111-221---112--1111133111111-1----1--------------1------------------------1111111111--1--1--1----------2---------11111111-111---------------------------------------------------------------------------------------------------------------11--11------------------------2----------------------------------------------------------------------11---111111111111-1111111111111111111111-----1111111111111111111111111--------------1--------------1------------------------------------------------------1--------------11111111111111---1--------------1----------------------------1-1-121111-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 125 STR:RPRED 86.8 SQ:SECSTR cHHHHHHHHHHHHHHHHHHTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEcTTccEEEcHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHccHHHHHHHHHHHHcccTTccc################### DISOP:02AL 1-1,138-138,141-145| PSIPRED cccHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEcccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHccHHHccHHHHHHHHHHHHHHHHccccc //