[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51229.1
DDBJ      :             FeoA family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.34.1
:74 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->74 3e19C PDBj 2e-08 31.1 %
:RPS:PDB   2->74 3e19B PDBj 6e-12 31.5 %
:RPS:SCOP  5->74 1bi0A3  b.34.1.2 * 6e-10 22.7 %
:HMM:SCOP  24->76 1fx7A3 b.34.1.2 * 1.6e-05 34.0 %
:RPS:PFM   5->73 PF04023 * FeoA 3e-07 42.0 %
:HMM:PFM   5->74 PF04023 * FeoA 4.2e-20 48.6 70/74  
:BLT:SWISS 5->73 Y567_METJA 7e-05 34.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51229.1 GT:GENE ABO51229.1 GT:PRODUCT FeoA family protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2952507..2952731) GB:FROM 2952507 GB:TO 2952731 GB:DIRECTION - GB:PRODUCT FeoA family protein GB:NOTE PFAM: FeoA family protein KEGG: tko:TK0958 iron(II) transport protein A GB:PROTEIN_ID ABO51229.1 GB:DB_XREF GI:134053258 InterPro:IPR007167 LENGTH 74 SQ:AASEQ MMHKPLSCMREGRIAYIQDIVGCPKRKRHLEEMGFTPGSPVEVCKCCCKGPLVVTIRGSKMMLGQEMAQDIMVR GT:EXON 1|1-74:0| BL:SWS:NREP 1 BL:SWS:REP 5->73|Y567_METJA|7e-05|34.3|67/100| BL:PDB:NREP 1 BL:PDB:REP 1->74|3e19C|2e-08|31.1|74/77| RP:PDB:NREP 1 RP:PDB:REP 2->74|3e19B|6e-12|31.5|73/75| RP:PFM:NREP 1 RP:PFM:REP 5->73|PF04023|3e-07|42.0|69/74|FeoA| HM:PFM:NREP 1 HM:PFM:REP 5->74|PF04023|4.2e-20|48.6|70/74|FeoA| GO:PFM:NREP 1 GO:PFM GO:0005506|"GO:iron ion binding"|PF04023|IPR007167| RP:SCP:NREP 1 RP:SCP:REP 5->74|1bi0A3|6e-10|22.7|66/77|b.34.1.2| HM:SCP:REP 24->76|1fx7A3|1.6e-05|34.0|53/0|b.34.1.2|1/1|C-terminal domain of transcriptional repressors| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 100.0 SQ:SECSTR ccEEEGGGccTTcEEEEEEEcccHHHHHHHHTTTccTTcEEEEEEccTTccEEEEETTEEEEEcHHHHTTEEEE DISOP:02AL 1-1| PSIPRED cEEEEHHHcccccEEEEEEEEccHHHHHHHHHcccccccEEEEEEcccccEEEEEEccEEEEEcHHHHHHHHcc //