[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51243.1
DDBJ      :             NLP/P60 protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  532/915 : Eukaryota  3/199 : Viruses  1/175   --->[See Alignment]
d.3.1d.7.1
:216 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   95->216 2k1gA PDBj 1e-26 44.6 %
:RPS:PDB   32->87 2djpA PDBj 3e-12 23.2 %
:RPS:SCOP  32->75 1e0gA  d.7.1.1 * 2e-12 34.9 %
:RPS:SCOP  85->216 2evrA2  d.3.1.16 * 7e-31 30.0 %
:HMM:SCOP  27->75 1e0gA_ d.7.1.1 * 3.1e-10 45.8 %
:HMM:SCOP  100->216 2evrA2 d.3.1.16 * 1.5e-41 52.6 %
:RPS:PFM   32->70 PF01476 * LysM 2e-05 53.8 %
:RPS:PFM   110->204 PF00877 * NLPC_P60 1e-21 57.4 %
:HMM:PFM   110->213 PF00877 * NLPC_P60 1.8e-33 49.0 102/105  
:HMM:PFM   32->73 PF01476 * LysM 1.8e-17 52.4 42/44  
:BLT:SWISS 33->212 CWLS_BACSU 4e-33 41.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51243.1 GT:GENE ABO51243.1 GT:PRODUCT NLP/P60 protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2966468..2967118) GB:FROM 2966468 GB:TO 2967118 GB:DIRECTION - GB:PRODUCT NLP/P60 protein GB:NOTE PFAM: NLP/P60 protein; Peptidoglycan-binding LysM KEGG: mta:Moth_2104 NLP/P60 GB:PROTEIN_ID ABO51243.1 GB:DB_XREF GI:134053272 InterPro:IPR000064 InterPro:IPR002482 LENGTH 216 SQ:AASEQ MLSLLKKMAVLTTTVCLATVVWVGSADAAQLTVQKGDSLWSIANRCGTSVDSLKQLNNLNSDSLKIGQILNVPDQVANQSVRPRTDSPDSSRGVVDRAVAVLDYAKQYIGVGYRSGGESPSGFDCSGYVRYVYKNFGIDLVHTAAGQYNAGSVVKRSELNPGDLVFFNTGGAGINHSGIYVGNNQFIHASTSRGIRIDSMSDSYWNTKFRGASRIL GT:EXON 1|1-216:0| BL:SWS:NREP 1 BL:SWS:REP 33->212|CWLS_BACSU|4e-33|41.2|177/414| TM:NTM 1 TM:REGION 8->30| SEG 9->21|avltttvclatvv| BL:PDB:NREP 1 BL:PDB:REP 95->216|2k1gA|1e-26|44.6|121/129| RP:PDB:NREP 1 RP:PDB:REP 32->87|2djpA|3e-12|23.2|56/77| RP:PFM:NREP 2 RP:PFM:REP 32->70|PF01476|2e-05|53.8|39/44|LysM| RP:PFM:REP 110->204|PF00877|1e-21|57.4|94/100|NLPC_P60| HM:PFM:NREP 2 HM:PFM:REP 110->213|PF00877|1.8e-33|49.0|102/105|NLPC_P60| HM:PFM:REP 32->73|PF01476|1.8e-17|52.4|42/44|LysM| GO:PFM:NREP 1 GO:PFM GO:0016998|"GO:cell wall macromolecule catabolic process"|PF01476|IPR018392| RP:SCP:NREP 2 RP:SCP:REP 32->75|1e0gA|2e-12|34.9|43/48|d.7.1.1| RP:SCP:REP 85->216|2evrA2|7e-31|30.0|130/148|d.3.1.16| HM:SCP:REP 27->75|1e0gA_|3.1e-10|45.8|48/48|d.7.1.1|1/1|LysM domain| HM:SCP:REP 100->216|2evrA2|1.5e-41|52.6|116/0|d.3.1.16|1/1|Cysteine proteinases| OP:NHOMO 1365 OP:NHOMOORG 536 OP:PATTERN -------------------------------------------------------------------- -112733433322224422-2D334233333476AA4459434E52314322-1-11122232234388861111111--222-21111111-122---324231432-4--------------1222222-121111111---31------1---------------1--------------22211---436344564554565565324457544534543353343563-1----------1-------3454333-121433322312-111111------------111-11-1--------1-----11---2-1-1315733345643527C22132232233--5116412111-121111--4111----------------------------------------------------------------------------------------------------------------------------22222222222222222222222222222222212222112222212212221111222222222211222--1-1-2-2312221333222212------211----1111---1-------1---422221-------1111111111111-1111111-1---1------45333434444444344-4444444444444444444444332223333333333333333334434442-333333333333---1---------1112-222222122211--1----------2-33333334333332333----------1111111111111122222222222222----111111--------1---------------------------1-----1------ --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1-----1---- --------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------- STR:NPRED 178 STR:RPRED 82.4 SQ:SECSTR ###############################cccTTccHHHHHHHHTccHHHHHHHHTcccccGGGcccEEEEEEcccccccccccc#######ccHHHHHHHHHHHHTTcccccccccTTcccHHHHHHHHHHHTcccccccHHHHGGGcEEEcGGGccTTEEEEEEETTTEEEEEEEEEETTEEEEEETTTEEEEEETTcHHHHHHEEEEEEcc DISOP:02AL 1-4| PSIPRED cHHHHHHHHHHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHcccHHHHHHHcccccccEEcccHHccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHcccccccccHHHHHHcccccHHHcccccEEEEccccccccEEEEEEEccEEEEEcccccEEEEEcccccHHcEEEEEEEcc //