[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51252.1
DDBJ      :             protein of unknown function DUF81
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:272 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->265 PF01925 * TauE 2.5e-36 23.9 226/239  
:BLT:SWISS 158->269 MRAY_STRPS 8e-06 32.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51252.1 GT:GENE ABO51252.1 GT:PRODUCT protein of unknown function DUF81 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2976357..2977175) GB:FROM 2976357 GB:TO 2977175 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF81 GB:NOTE PFAM: protein of unknown function DUF81 KEGG: btk:BT9727_1504 membrane protein GB:PROTEIN_ID ABO51252.1 GB:DB_XREF GI:134053281 InterPro:IPR002781 LENGTH 272 SQ:AASEQ MYESIFAGLIVFFASVLQASTGFGFAIMATPFLLLVFDSRDCIQISIFLSLFIALILMPKIKHEIDLDILKRLIHGSILGIPIGLGFFIYVSLDILKASVSAVILMISIFLIIKWYQTHFRKTVEGPIDKTKECKDAIEADQNSILKVMKESERRNEVFVGLTAGILTTSLGMPGVPLAIYFTAQNVKKETIRSTTLAFFIVVYIVSIIMQVFSVKISTEVLFTSLYLIPTAAVGVFLGNILFYKINQRMFQLIANLILIYTGFYIFYKTLL GT:EXON 1|1-272:0| BL:SWS:NREP 1 BL:SWS:REP 158->269|MRAY_STRPS|8e-06|32.4|111/326| TM:NTM 6 TM:REGION 9->31| TM:REGION 39->60| TM:REGION 85->107| TM:REGION 193->215| TM:REGION 221->243| TM:REGION 250->272| SEG 45->57|isiflslfialil| SEG 73->86|lihgsilgipiglg| HM:PFM:NREP 1 HM:PFM:REP 9->265|PF01925|2.5e-36|23.9|226/239|TauE| OP:NHOMO 24 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111-111111------111---11-------------------------------------------------------------------------------------------------------------------------------------11-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //