[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51261.1
DDBJ      :             TRAP dicarboxylate transporter, DctP subunit
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  316/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:346 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   60->336 2ceyA PDBj 1e-35 30.6 %
:RPS:PDB   40->341 2ceyA PDBj 3e-33 27.3 %
:RPS:SCOP  160->285 1h3dA1  c.94.1.1 * 1e-08 9.8 %
:HMM:SCOP  23->82 1y3nA1 c.94.1.1 * 0.00055 17.6 %
:RPS:PFM   60->329 PF03480 * SBP_bac_7 4e-50 40.2 %
:HMM:PFM   45->330 PF03480 * SBP_bac_7 9.1e-84 40.4 282/286  
:BLT:SWISS 40->339 Y1028_HAEIN 1e-42 31.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51261.1 GT:GENE ABO51261.1 GT:PRODUCT TRAP dicarboxylate transporter, DctP subunit GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2990088..2991128) GB:FROM 2990088 GB:TO 2991128 GB:DIRECTION - GB:PRODUCT TRAP dicarboxylate transporter, DctP subunit GB:NOTE TIGRFAM: TRAP dicarboxylate transporter, DctP subunit PFAM: TRAP dicarboxylate transporter- DctP subunit KEGG: dvl:Dvul_0493 TRAP dicarboxylate transporter, DctP subunit GB:PROTEIN_ID ABO51261.1 GB:DB_XREF GI:134053290 InterPro:IPR000437 InterPro:IPR004682 LENGTH 346 SQ:AASEQ MKRNKTLVGLLALLIILSLTLVGCGSDKGDKKEGATDGKKITIRLAHPMAPGNNVTLGYEKFKELVEKKSNGKVEIQLYGNTVLGSDRVTMESVQKGTLEMASSSSPNMANFSPKFMVFDLPYITQPENQQKLYKALDEGELGKYFDKVSEEIGLKPIMWSEYGYRNFVAAKQELNGAEDLKNLKLRTTDSPVEVAVAKALGANPTPIAWGEVYTALQQGTIDGEGNTFGLLYSAKHHEALKYAMDSEHNYSMHLLMINKKYFDGLPKDIQDILVESGKEALAYQRQVSAELEEKAKQDFINAGIKVHELTPEEKAKFKELTKGVWTMFPDKIPQELIDMVVNAQK GT:EXON 1|1-346:0| BL:SWS:NREP 1 BL:SWS:REP 40->339|Y1028_HAEIN|1e-42|31.2|288/328| TM:NTM 1 TM:REGION 5->25| SEG 6->23|tlvgllalliilsltlvg| BL:PDB:NREP 1 BL:PDB:REP 60->336|2ceyA|1e-35|30.6|271/306| RP:PDB:NREP 1 RP:PDB:REP 40->341|2ceyA|3e-33|27.3|297/306| RP:PFM:NREP 1 RP:PFM:REP 60->329|PF03480|4e-50|40.2|266/284|SBP_bac_7| HM:PFM:NREP 1 HM:PFM:REP 45->330|PF03480|9.1e-84|40.4|282/286|SBP_bac_7| GO:PFM:NREP 2 GO:PFM GO:0006810|"GO:transport"|PF03480|IPR018389| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF03480|IPR018389| RP:SCP:NREP 1 RP:SCP:REP 160->285|1h3dA1|1e-08|9.8|123/220|c.94.1.1| HM:SCP:REP 23->82|1y3nA1|0.00055|17.6|51/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 990 OP:NHOMOORG 323 OP:PATTERN --1-------------------------1-------------------------------1------- -------1111--------------2------------------1-1-------1-----------1--------------------------1----------1------------------------------1--------------------------------------------------2222---1---------------841111---13416--------1---------------------1----------------------------------------------------------------------71-----------------------2--11--66-21---31-----2-----11--------C9A--143332--1---1-114-22922A235---16612154339B642-295A679BA7C--------2----3-2-----------------------------------1DA692222211----2231-----22134332-2---A-74459J7E5212----12----------433-FA4A2531-4333-1111--11-1111---4123---------1--------221-------423-3-621222-2-222212--212---112-------21--11-1--3133322--212323141-22111116---1111-3-323223333-3-222---1122--111111111111---1----------25FN---816-2322-446-------22-114444-112911128121---------1--164444442556--11111---------3-11---------------------------------------------12121--- --------------------------------------------------------------------------------------------------------------------------------------------------------------4----1---------1--------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 309 STR:RPRED 89.3 SQ:SECSTR #####################################cccEEEEEEccccTTcHHHHHHHHHHHHHHHHTTTcEEEEEEcTTTTccHHHHHHHHHHTcccEEEEcGGGGGGTcGGGGGGGcTTTcccHHHHHHHHHHHccHHHHHHHHHHHHTTcEEEEEEEEEEEEEEEEccccccGGGGTTcEEEEcccHHHHHHHHHTTcEEEEccGGGHHHHHHTTcccEEEEEHHHHHHTTGGGTccEEEcccccEEEEEEEEEHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcEEEccccHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHH DISOP:02AL 1-3,32-34,346-347| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHcccEEEEEEcccHHccccHHHHHHccccccccHHHHHHHHHHHccHHHHHHHHHHHHcccEEEEEcccccEEEEEcccccccHHHHcccEEEEcccHHHHHHHHHcccEEEEccHHHHHHHHHcccEEEEEccHHHHHHccccccccEEEccccccccEEEEEEHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccEEEEccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHc //