[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51265.1
DDBJ      :             4-diphosphocytidyl-2C-methyl-D-erythritol synthase
Swiss-Prot:             

Homologs  Archaea  17/68 : Bacteria  174/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.68.1
:197 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->179 3d5nA PDBj 5e-13 32.1 %
:RPS:PDB   1->193 3cgxA PDBj 3e-20 12.8 %
:RPS:SCOP  2->191 1qwjA  c.68.1.13 * 4e-21 16.9 %
:HMM:SCOP  1->193 1g97A2 c.68.1.5 * 1.1e-33 33.3 %
:RPS:PFM   3->125 PF01128 * IspD 3e-11 35.0 %
:HMM:PFM   5->118 PF01128 * IspD 2.1e-12 31.5 111/221  
:BLT:SWISS 4->184 PUCB_BACSU 5e-14 34.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51265.1 GT:GENE ABO51265.1 GT:PRODUCT 4-diphosphocytidyl-2C-methyl-D-erythritol synthase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2995639..2996232) GB:FROM 2995639 GB:TO 2996232 GB:DIRECTION - GB:PRODUCT 4-diphosphocytidyl-2C-methyl-D-erythritol synthase GB:NOTE PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase; Nucleotidyl transferase KEGG: gme:Gmet_2140 conserved hypothetical protein, possibly involved in molybdenum cofactor biosynthesis GB:PROTEIN_ID ABO51265.1 GB:DB_XREF GI:134053294 InterPro:IPR001228 InterPro:IPR005835 LENGTH 197 SQ:AASEQ MISGVILAAGLSRRMGCPKQLLQLGNKTLLEHVVTHALRARLDEVIVVTGAYREDIKQALEGYAVNFVNNDRYEEGQGTSLAAGISAVSPKAKGILFLLADQPFVCPEMMNRISDAFLETGAPIVRAGANGHPVLFASDFREQLLQLRGDSGGRQIIEKMKNKLLTIKPCPYFVSLDIDTPDQYRRILALYTGSQGF GT:EXON 1|1-197:0| BL:SWS:NREP 1 BL:SWS:REP 4->184|PUCB_BACSU|5e-14|34.3|181/205| BL:PDB:NREP 1 BL:PDB:REP 2->179|3d5nA|5e-13|32.1|168/173| RP:PDB:NREP 1 RP:PDB:REP 1->193|3cgxA|3e-20|12.8|188/223| RP:PFM:NREP 1 RP:PFM:REP 3->125|PF01128|3e-11|35.0|123/222|IspD| HM:PFM:NREP 1 HM:PFM:REP 5->118|PF01128|2.1e-12|31.5|111/221|IspD| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01128|IPR001228| GO:PFM GO:0008299|"GO:isoprenoid biosynthetic process"|PF01128|IPR001228| RP:SCP:NREP 1 RP:SCP:REP 2->191|1qwjA|4e-21|16.9|189/228|c.68.1.13| HM:SCP:REP 1->193|1g97A2|1.1e-33|33.3|189/250|c.68.1.5|1/1|Nucleotide-diphospho-sugar transferases| OP:NHOMO 209 OP:NHOMOORG 192 OP:PATTERN ----1-1111111111--111---1---1--------------------------------1------ 111-1------------11-1---1-111111--------------------1-1----------1----------------1------------------1-111-1----------------------------11111----1-1-111---------------1-1--------------1--------1-----1----------1---1----21--------------------------------1----------------------------------------------------------------------12-22222222212-1------11-11-11--212121-111-------------1-----1-11111111111-------------------1111-1111--121-11111---1-1---1--11111111--111111-----------------------------------1------------------1--------1---1-1----1-----------1--11------------1----1-1111-1111---11121111----11-1--------------------------------1--1-------------------------1------------------------------1--------------------------------------1------------------------------------11--------------------------1-----1-1--11-1--1--11111111---------------11------------------------------------------------------------1--------1- -----------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 193 STR:RPRED 98.0 SQ:SECSTR EEEEccccTTccHHHHHHcHHHHHHHHHHHHHHHHHTTcccEEEEEEccccTTHHHHHHHHHcTTcEEEcccccccHHHHHHHHHHHHHHTTccEEEEccccTTccHHHHHHHHHHTTTccEEEEEcTTcEEEEEEEGGGccGGGGTTccTTTcccHHHHHHHHHTTccEccccGcccccHHHHHHHHHHcTT#### DISOP:02AL 193-198| PSIPRED cEEEEEEcccccccccccccEEEEccEEHHHHHHHHHHHccccEEEEEEcccHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHHHHccccEEEcccccccccccHHHHHHHHHHccccHHHHHHHHccccEEEEEEccccEEEEcccHHHHHHHHHHHcccccc //