[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51269.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:137 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   21->61 PF05223 * MecA_N 0.00078 14.6 41/118  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51269.1 GT:GENE ABO51269.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2998417..2998830) GB:FROM 2998417 GB:TO 2998830 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO51269.1 GB:DB_XREF GI:134053298 LENGTH 137 SQ:AASEQ MIIILMVGWIIGSFLPGERQATHRVQEFIDAVNDNRPRDIYLYLTPQLREKISREDFTRNFAKERSYPYLTPLYLYLDEVKLSPDKQTGEAILTVAARLPGEKMRVHLVYYRGHYYIEAFKEIVDGSYQDKFQKLKR GT:EXON 1|1-137:0| SEG 67->77|ypyltplylyl| HM:PFM:NREP 1 HM:PFM:REP 21->61|PF05223|0.00078|14.6|41/118|MecA_N| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 136-138| PSIPRED ccHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccEEEEEEEcHHHHHHHHHHHHHHHHHHHccccccccHHEEEEHHccccccccccEEEEHHHcccccEEEEEEEEEcHHHHHHHHHHHHcccHHHHHHHHcc //