[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51291.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.1.18c.119.1c.69.1
:586 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   141->191 1mz6A PDBj 6e-04 39.2 %
:RPS:PDB   282->528 2a73B PDBj 8e-05 15.0 %
:RPS:SCOP  21->63 2b61A1  c.69.1.40 * 3e-04 14.0 %
:RPS:SCOP  87->164 1oi2A  c.119.1.2 * 1e-04 27.4 %
:RPS:SCOP  223->295 1nepA  b.1.18.7 * 4e-04 17.9 %
:RPS:PFM   174->237 PF03886 * DUF330 3e-04 33.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51291.1 GT:GENE ABO51291.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3022290..3024050) GB:FROM 3022290 GB:TO 3024050 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: mta:Moth_0321 hypothetical protein GB:PROTEIN_ID ABO51291.1 GB:DB_XREF GI:134053320 LENGTH 586 SQ:AASEQ MKKKIPIWAIMMMIAFFFTSITPALAEPEEQLFHRLIISGYYAMYQDGSGHWVAEEFPGQVNRVKPGDTRSMLIGQIPCNVKAKGKITRVEVKTADQITEEMFDKNTSEGSKTSLWRPMDFKEFDPMYLRYISGSITPSFTMKNDQGDVEVTANVLLGPINNAVRVAKEPDLARYYANATWAPNSSAVLWTVPVVVEWYGIPLAPVGPPDFSVQLELERFKNVKPGDKVTSTVTYTLNKDYPQQERAWLRLHHVLGGQEYAVTFEPINSADALDANGYVTFQPGESKTYRYTFTVQDKPSKILARINPVDTDQDKYWPNNRDEALVTMQNLRVEIISKPESAHPGEPVSVGARIFNEMADMQVTRLVAKINGKVVYDIDNFDVISMADKAVNFKMPDSDATVEFYINPDREKPADEITYADNIAKCTIKKLAPIIDNDGNLKVTIMAPSRVQPFKKWTFTVKVEGRFPPPPPPPSKDDDPTATISLKVNGKAVNIDYHLSEGTWGDVVVDTKVPVNYQKSTGITVPRGKKFSKTVTFTFPATTGFPGQDYPINLHAKATWRNYNGEDTSKTMIFLKPMEPEAQITL GT:EXON 1|1-586:0| SEG 468->474|ppppppp| SEG 534->547|tvtftfpattgfpg| BL:PDB:NREP 1 BL:PDB:REP 141->191|1mz6A|6e-04|39.2|51/620| RP:PDB:NREP 1 RP:PDB:REP 282->528|2a73B|8e-05|15.0|220/976| RP:PFM:NREP 1 RP:PFM:REP 174->237|PF03886|3e-04|33.3|63/158|DUF330| RP:SCP:NREP 3 RP:SCP:REP 21->63|2b61A1|3e-04|14.0|43/357|c.69.1.40| RP:SCP:REP 87->164|1oi2A|1e-04|27.4|73/336|c.119.1.2| RP:SCP:REP 223->295|1nepA|4e-04|17.9|67/130|b.1.18.7| OP:NHOMO 5 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------121----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 271 STR:RPRED 46.2 SQ:SECSTR ############################################################################################################################################EEETTEEEEEETTEEcTTTTcccccccccccEEEEEEEcccccccccEEEE##########################################################################################ccTTccccccccccccccEEE##EEccEEEETTTEEEEcccEEEEEcccEEEEE#EcccEEETTcEEEEEEEEEEccccccEEEEE######EEcccTTEEccccccccEEEEETTEEEEEEEEEEEcccEEEEEEEEcccccEEEEEEEEEEEcccEEEEEEEEccEEcTcTTTccccc##############EEEEcccccTTccTTcccEE####EEEEEcccccHHHHHHHcTTTGGcccccc########################################################## DISOP:02AL 1-2,106-106,469-479,583-583,586-587| PSIPRED cccccHHHHHHHHHHHHHHcccHHHccHHHHHHHHHHHccEEEEEEcccccEEHHHccccccccccccccEEEEEEcccccccccEEEEEEEEcHHHHHHHHHccccccccccccccccccccccEEEEEEEccccccEEEEEcccccEEEEEEEEEEcccccEEEEccccHHHEEccccccccccEEEEEEEEEEEEccccccccccccEEEEEEcccccccccccEEEEEEEEEEcccccccEEEEEEEEEEccccEEcccccccccccccccccEEEEccccccEEEEEEEEcccccEEEEEEccccccccccccccccEEEEEEEEEEEEEEEccccccccccEEHHHHHHHHHHHHHHHHHEEEEccEEEEEEcccEEEEEEccEEEEEccccccEEEEEEcccccccccccEEccccHHEEHHHHcccccccccEEEEEEcccccccccEEEEEEEEccccccccccccccccccEEEEEEEccEEEEEEEEEccccccEEEEEEcccccEEcccccccccccccEEEEEEEEccccccccccccEEEEEEEEEcccccccccEEEEEEEccccccEEcc //