[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51296.1
DDBJ      :             transcriptional regulator, XRE family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:124 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->72 2ef8B PDBj 6e-12 32.4 %
:RPS:SCOP  1->71 2aw6A1  a.35.1.11 * 2e-11 26.1 %
:HMM:SCOP  1->76 1x57A1 a.35.1.12 * 5.1e-13 41.3 %
:RPS:PFM   8->63 PF01381 * HTH_3 8e-04 43.6 %
:HMM:PFM   8->63 PF01381 * HTH_3 3.7e-13 40.0 55/55  
:BLT:SWISS 3->93 IMMR_BACSU 1e-08 35.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51296.1 GT:GENE ABO51296.1 GT:PRODUCT transcriptional regulator, XRE family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 3026807..3027181 GB:FROM 3026807 GB:TO 3027181 GB:DIRECTION + GB:PRODUCT transcriptional regulator, XRE family GB:NOTE PFAM: helix-turn-helix domain protein KEGG: btl:BALH_p0025 transcriptional regulator GB:PROTEIN_ID ABO51296.1 GB:DB_XREF GI:134053325 InterPro:IPR001387 LENGTH 124 SQ:AASEQ MPTLGQRIKELREKFSLTQKDLALVIGFTSARSIQYIEADKRGLDHNALITLADYFNVSLDYLLGRSDDPTPSQTQSTESAKKLYDVIARAKDLPEQNIEELTDTLDALIGVHLKKLKSKGKKQ GT:EXON 1|1-124:0| BL:SWS:NREP 1 BL:SWS:REP 3->93|IMMR_BACSU|1e-08|35.2|88/127| SEG 114->123|lkklkskgkk| RP:PDB:NREP 1 RP:PDB:REP 1->72|2ef8B|6e-12|32.4|71/82| RP:PFM:NREP 1 RP:PFM:REP 8->63|PF01381|8e-04|43.6|55/55|HTH_3| HM:PFM:NREP 1 HM:PFM:REP 8->63|PF01381|3.7e-13|40.0|55/55|HTH_3| GO:PFM:NREP 1 GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| RP:SCP:NREP 1 RP:SCP:REP 1->71|2aw6A1|2e-11|26.1|69/69|a.35.1.11| HM:SCP:REP 1->76|1x57A1|5.1e-13|41.3|75/0|a.35.1.12|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 26 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11111--1-1---11-------11-2-------------------------------------------------------------1------------------------11-------------------------------1------------------14----1-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 107 STR:RPRED 86.3 SQ:SECSTR HHHHHHHHHHHHHHTTccHHHHHHHHTcccHHHHHHHHTTcccccHHHHHHHHHHHTccHHHHHHHHHHHccHHHHTcHHHHHHHHHcccHHHHHHHHHHHHHHcHH################# DISOP:02AL 1-1,117-117,120-125| PSIPRED ccHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccc //