[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51299.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:120 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   48->102 PF03255 * ACCA 0.00027 20.0 55/145  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51299.1 GT:GENE ABO51299.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3030357..3030719) GB:FROM 3030357 GB:TO 3030719 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO51299.1 GB:DB_XREF GI:134053328 LENGTH 120 SQ:AASEQ MVRIIKFKVTGLGFLSGGTYDNWEEAVANLKDSKGRTGTIIVEMTGKEYYRMVNGYRQKLNELNEMIRKRDYDHKQNIIQQESQYQQQLNQLVSQLKEKDKRCATLAAVVNRLKNKQKSN GT:EXON 1|1-120:0| SEG 76->95|qniiqqesqyqqqlnqlvsq| HM:PFM:NREP 1 HM:PFM:REP 48->102|PF03255|0.00027|20.0|55/145|ACCA| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,82-82,88-88,112-113,115-121| PSIPRED ccEEEEEEEEEEEEEcccccccHHHHHHHHHHcccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //