[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51310.1
DDBJ      :             L-glutamine synthetase
Swiss-Prot:             

Homologs  Archaea  66/68 : Bacteria  788/915 : Eukaryota  144/199 : Viruses  0/175   --->[See Alignment]
d.128.1d.15.9
:449 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->445 1f1hA PDBj 2e-79 45.7 %
:RPS:PDB   10->446 2bvcA PDBj e-128 38.7 %
:RPS:SCOP  10->109 1f1hA1  d.15.9.1 * 3e-30 38.8 %
:RPS:SCOP  112->446 1f1hA2  d.128.1.1 * e-107 44.7 %
:HMM:SCOP  10->110 1htqA1 d.15.9.1 * 8.9e-35 51.5 %
:HMM:SCOP  110->448 1f52A2 d.128.1.1 * 5.4e-125 48.1 %
:RPS:PFM   24->103 PF03951 * Gln-synt_N 1e-19 56.4 %
:RPS:PFM   112->359 PF00120 * Gln-synt_C 3e-66 51.2 %
:HMM:PFM   112->359 PF00120 * Gln-synt_C 6.3e-102 54.7 247/258  
:HMM:PFM   22->104 PF03951 * Gln-synt_N 8.3e-35 55.4 83/84  
:BLT:SWISS 6->449 GLNA_CLOSA e-171 63.9 %
:PROS 57->75|PS00180|GLNA_1
:PROS 238->253|PS00181|GLNA_ATP

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51310.1 GT:GENE ABO51310.1 GT:PRODUCT L-glutamine synthetase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3043818..3045167) GB:FROM 3043818 GB:TO 3045167 GB:DIRECTION - GB:PRODUCT L-glutamine synthetase GB:NOTE KEGG: chy:CHY_0704 glutamine synthetase TIGRFAM: glutamine synthetase, type I PFAM: glutamine synthetase, catalytic region; glutamine synthetase, beta-Grasp GB:PROTEIN_ID ABO51310.1 GB:DB_XREF GI:134053339 InterPro:IPR004809 InterPro:IPR008146 InterPro:IPR008147 LENGTH 449 SQ:AASEQ MCYCIVAKLTNDDVRQLCKELNVKFIRLQFTDIFGVLKNVAITVEQLDKALEGEMMFDGSSIEGFVRIEESDMYLRPDPSTFVVYPWKPRDGAVARLICDIYNPDGTPFIGDPRYALRRAIAEAEEMGYSMNVGPEAEFFLFHVDSEGRPTTKTHDRAGYFDMTPIDLGEDARRDMVLTLEQMGFEIEASHHEVAPGQHEIDFKYSDALDVADKIVTFKLAVRTVAQRHGLHATFMPKPVFGMAGSGMHLNQSLITKDGKNAFYDTTTPNGMSQISMNYIAGLMNHINAITAIINPTVNSYKRLVSGYEAPVYVAWSAQNRSPLIRIPAKRGMSTRIELRSPDPSCNPYLALAVCLRAGLDGIKKGMVPPSPCDRNIYEMTLAERQEMSIANLPENLSEAIKALAADEVIKEALGPHIFERYMEAKNIEWDRYRMQVSPWELEEYLTKF GT:EXON 1|1-449:0| BL:SWS:NREP 1 BL:SWS:REP 6->449|GLNA_CLOSA|e-171|63.9|443/443| PROS 57->75|PS00180|GLNA_1|PDOC00162| PROS 238->253|PS00181|GLNA_ATP|PDOC00162| BL:PDB:NREP 1 BL:PDB:REP 12->445|1f1hA|2e-79|45.7|427/468| RP:PDB:NREP 1 RP:PDB:REP 10->446|2bvcA|e-128|38.7|432/475| RP:PFM:NREP 2 RP:PFM:REP 24->103|PF03951|1e-19|56.4|78/80|Gln-synt_N| RP:PFM:REP 112->359|PF00120|3e-66|51.2|248/256|Gln-synt_C| HM:PFM:NREP 2 HM:PFM:REP 112->359|PF00120|6.3e-102|54.7|247/258|Gln-synt_C| HM:PFM:REP 22->104|PF03951|8.3e-35|55.4|83/84|Gln-synt_N| GO:PFM:NREP 5 GO:PFM GO:0004356|"GO:glutamate-ammonia ligase activity"|PF03951|IPR008147| GO:PFM GO:0006542|"GO:glutamine biosynthetic process"|PF03951|IPR008147| GO:PFM GO:0006807|"GO:nitrogen compound metabolic process"|PF03951|IPR008147| GO:PFM GO:0004356|"GO:glutamate-ammonia ligase activity"|PF00120|IPR008146| GO:PFM GO:0006807|"GO:nitrogen compound metabolic process"|PF00120|IPR008146| RP:SCP:NREP 2 RP:SCP:REP 10->109|1f1hA1|3e-30|38.8|98/100|d.15.9.1| RP:SCP:REP 112->446|1f1hA2|e-107|44.7|331/368|d.128.1.1| HM:SCP:REP 10->110|1htqA1|8.9e-35|51.5|99/0|d.15.9.1|1/1|Glutamine synthetase, N-terminal domain| HM:SCP:REP 110->448|1f52A2|5.4e-125|48.1|335/0|d.128.1.1|1/1|Glutamine synthetase/guanido kinase| OP:NHOMO 1947 OP:NHOMOORG 998 OP:PATTERN 11-11123323333331121111111111112111111111112123121222111111111111-22 2234322322222324444-45223A444442999933554544322222224323231123424243432222222211114111111111-1----------1-2111--------------1-----------333332112411141111222111221111211221111111111112221121132111111-111111111221111111122311211111122111111111111111211111111221111111112211111111111111111111111111111111111111111111111111111131111111111112111111112131-12213115372133422111-111-333122222124341113113133333333334-34133332386255545545557645111354555565711111111411131342221122211----------------1--3122311111145545422222443533332345211311111233111124214111141342111111111112211221111111111-11111111111112211111111111111111111111111111221111211113433322322222223233---1123------13111112221211122-2222211222212222221222111111111111111111111422222222111111111111111-1-----222211353111111111-1111122232221114188889887989884455---------31112111111211122333334441111111-111111------------------------------------22122121111-- 111123--1-1-222212224526364332212433322212221222133334331222221--------1----1-11------1--35213271121111334--21-111122-11-12-11111271-21211111-11111-1-21-112112---58---3-2--211-1---1-1116111312-2----4 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 441 STR:RPRED 98.2 SQ:SECSTR #####HTcccHHHHHHHHHHTTccEEEEEEEcccccEEEEEEEGGGccHHHHTcEEEETTccTTcccGGGcEEEEEEcGGGcEEcccccccccEEEEEEEEEcTTccccTTcHHHHHHHHHHHHHHHcccEEEEEEEcEEEEcEEccccccccccTTccccccTTTcccHHHHHHHHHHHHHTTccEEEEEEcccTTEEEEEEccEEHHHHHHHHHHHHHHHHHHHHHTTcEEEccccccTTcccccEEEEEEETEETTEEccccTTcGGGccHHHHHHHHHHHHHHHHHHHHHcccTTHHHHccTTccccccccEEETcTTccEEEccccTTcccEEEccccccccHHHHHHHHHHHHHHHHHTTccccccccccGGGccHHHHHTHHcccccccHHHHHHHHHHccHHHHGccHHHHHHHHHHHHHTHHHHHTcccHHHHHHHT### DISOP:02AL 1-1,3-7| PSIPRED cHHHHHHHccHHHHHHHHHHccccEEEEEEEccccEEEEEEEEHHHHHHHHHccccccccccccccccccccEEEEEEcccEEEcccccccccEEEEEEEEEcccccEEcccHHHHHHHHHHHHHHcccEEEEEEccEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccccccccEEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHccccccccccEEccccccccEEEcccccccccEEEEccccccccHHHHHHHHHHHHHHHHHHcccccccccccHHHccHHHHHHcccccccccHHHHHHHHHccHHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHc //