[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51314.1
DDBJ      :             Glutamate--ammonia ligase
Swiss-Prot:             

Homologs  Archaea  66/68 : Bacteria  760/915 : Eukaryota  130/199 : Viruses  0/175   --->[See Alignment]
d.128.1d.15.9
:432 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->428 1f1hA PDBj 2e-49 35.4 %
:RPS:PDB   5->429 2bvcA PDBj 3e-93 30.0 %
:RPS:SCOP  5->104 1f1hA1  d.15.9.1 * 2e-19 26.5 %
:RPS:SCOP  109->429 1f1hA2  d.128.1.1 * 2e-83 36.6 %
:HMM:SCOP  5->105 1f52A1 d.15.9.1 * 1.2e-24 36.4 %
:HMM:SCOP  105->431 1f52A2 d.128.1.1 * 8.4e-97 44.5 %
:RPS:PFM   19->98 PF03951 * Gln-synt_N 3e-13 46.2 %
:RPS:PFM   109->353 PF00120 * Gln-synt_C 3e-48 44.4 %
:HMM:PFM   106->353 PF00120 * Gln-synt_C 6.6e-77 43.3 247/258  
:HMM:PFM   18->98 PF03951 * Gln-synt_N 5.1e-23 44.4 81/84  
:BLT:SWISS 7->432 GLNA_CLOSA e-106 46.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51314.1 GT:GENE ABO51314.1 GT:PRODUCT Glutamate--ammonia ligase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3049312..3050610) GB:FROM 3049312 GB:TO 3050610 GB:DIRECTION - GB:PRODUCT Glutamate--ammonia ligase GB:NOTE PFAM: glutamine synthetase, catalytic region; glutamine synthetase, beta-Grasp KEGG: chy:CHY_0704 glutamine synthetase GB:PROTEIN_ID ABO51314.1 GB:DB_XREF GI:134053343 InterPro:IPR008146 InterPro:IPR008147 LENGTH 432 SQ:AASEQ MQLLNAQEVMEKAQECHVKFVRLQFTDIQGSFKNVAVTVEELERALQSRISLDSAVLEGKYGAHQRDVFLKPDPTTFEVFPWRPREGAVARLICDVVDATGKPYPGCVRSKLRDSLARLEKNNLELSVGAEIEFFLFQTNQQGHPISCPHDNAGLCDLTPVDLGENARRDMVLTLEAMGFQIVSSHHESAPGQHEIVLREEDPLGMADKIATFKFVVRTIAQRHGLHASFMPKPLPKYNGSGMALNLCLWRDGTNALWEDAGSYGLSSWAGSFIAGITNHAPAITAVANPLVNSYKRLGNSNLDRVLKGWSEGNRNSMIRVPGQRGNDTRIVWRSPDATCNPYLALCLVMQAGLAGIEQNLPLPTSLDEDTFDHRVPRNLGEALDALMQDAFVKGILGEVIFKRYMDFKKQEWEEFHNHVHPWEIEKYLTNY GT:EXON 1|1-432:0| BL:SWS:NREP 1 BL:SWS:REP 7->432|GLNA_CLOSA|e-106|46.0|426/443| BL:PDB:NREP 1 BL:PDB:REP 5->428|1f1hA|2e-49|35.4|415/468| RP:PDB:NREP 1 RP:PDB:REP 5->429|2bvcA|3e-93|30.0|423/475| RP:PFM:NREP 2 RP:PFM:REP 19->98|PF03951|3e-13|46.2|78/80|Gln-synt_N| RP:PFM:REP 109->353|PF00120|3e-48|44.4|243/256|Gln-synt_C| HM:PFM:NREP 2 HM:PFM:REP 106->353|PF00120|6.6e-77|43.3|247/258|Gln-synt_C| HM:PFM:REP 18->98|PF03951|5.1e-23|44.4|81/84|Gln-synt_N| GO:PFM:NREP 5 GO:PFM GO:0004356|"GO:glutamate-ammonia ligase activity"|PF03951|IPR008147| GO:PFM GO:0006542|"GO:glutamine biosynthetic process"|PF03951|IPR008147| GO:PFM GO:0006807|"GO:nitrogen compound metabolic process"|PF03951|IPR008147| GO:PFM GO:0004356|"GO:glutamate-ammonia ligase activity"|PF00120|IPR008146| GO:PFM GO:0006807|"GO:nitrogen compound metabolic process"|PF00120|IPR008146| RP:SCP:NREP 2 RP:SCP:REP 5->104|1f1hA1|2e-19|26.5|98/100|d.15.9.1| RP:SCP:REP 109->429|1f1hA2|2e-83|36.6|320/368|d.128.1.1| HM:SCP:REP 5->105|1f52A1|1.2e-24|36.4|99/0|d.15.9.1|1/1|Glutamine synthetase, N-terminal domain| HM:SCP:REP 105->431|1f52A2|8.4e-97|44.5|326/0|d.128.1.1|1/1|Glutamine synthetase/guanido kinase| OP:NHOMO 1857 OP:NHOMOORG 956 OP:PATTERN 11-11123323333331121111111111112111111111112123121222111111111111-22 2234322322222324444-45222A444442999933544544322222224323231123424243432222222211114111111111-1------------111---------------------------333332112411141111222111221111211221111111111112111121132111111-11111111122111111112231121111112211111111111111121111111122111111111221111111111111111111111111111111111111111111111111111112--1---------1--------1-1--11113115372133411-11--11-333122222124341113113133333333334-34133332386255545545557645111354555565711111111411131341111111111-------------------3122311111145545422222443533332345211311111233111124214111141342111111111112211211111-11111-11111111111112211111111111111111111111111111221111211113433322322222223233---1123------13111112221211122-2222211222212222221222111111111111111111111422222221111111111111111-1-----222211353111111111-1111122222221114188889887989884455---------31112111111211122333334441111111-111111------------------------------------22122121111-- 111122--1---11221212452636433221243332221222-222133233321222221-----------------------1--35213251111121112--21-1-1122-11-12-11111271-21211111-11111-1-21-1-2112---48---------1--1------115111212-1----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 429 STR:RPRED 99.3 SQ:SECSTR HTcccHHHHHHHHHHTTccEEEEEEEcccccEEEEEEEGGGccHHHHTcEEEETTccTTcccGGGcEEEEEEcGGGcEEcccccccccEEEEEEEEEcTTccccTTcHHHHHHHHHHHHHHcccEEEEEEEEcEEEEcTTccccTTccccTTccccccTTTcccHHHHHHHHHHHHHTTccEEEEEEcccTTEEEEEEccEEHHHHHHHHHHHHHHHHHHHHHTTcEEEccccccTTcccccEEEEEEEEETTEEccccTTcGGGccHHHHHHHHHHHHHHHHHHHHHcccTTHHHHccTTccccccccEEETcTTccEEEccccccTccEEEccccccccHHHHHHHHHHHHHHHHHTTccccccccccGGGccccccHHHHHHHHHHcHHGGGcccHHHHHHHHHHHHHTHHHHHTcccHHHHHHHT### DISOP:02AL 1-4| PSIPRED cccccHHHHHHHHHHccccEEEEEEEcccccEEEEEEEHHHHHHHHHccccccccccccccccccccEEEEEEccccEEcccccccccEEEEEEEEEccccccccccHHHHHHHHHHHHHHccccEEEEcccEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHccEEEEEcccccccccccEEEEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEccccccccEEEEccccccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHcccHHHHHHHHHccHHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcc //