[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51323.1
DDBJ      :             nitrogen regulatory protein P-II
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  494/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
d.58.5
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->126 2gw8A PDBj 5e-16 44.9 %
:RPS:PDB   1->126 3bzqA PDBj 1e-20 39.2 %
:RPS:SCOP  1->126 1gnkA  d.58.5.1 * 5e-17 35.7 %
:HMM:SCOP  1->126 1gnkA_ d.58.5.1 * 8.2e-28 51.8 %
:RPS:PFM   6->119 PF00543 * P-II 4e-11 48.0 %
:HMM:PFM   4->119 PF00543 * P-II 2.6e-30 51.0 100/102  
:BLT:SWISS 1->126 GLNB2_METBA 2e-24 48.7 %
:PROS 27->37|PS00639|THIOL_PROTEASE_HIS

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51323.1 GT:GENE ABO51323.1 GT:PRODUCT nitrogen regulatory protein P-II GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3061177..3061557) GB:FROM 3061177 GB:TO 3061557 GB:DIRECTION - GB:PRODUCT nitrogen regulatory protein P-II GB:NOTE PFAM: nitrogen regulatory protein P-II KEGG: det:DET1156 nitrogen regulatory protein P-II GB:PROTEIN_ID ABO51323.1 GB:DB_XREF GI:134053352 InterPro:IPR000169 InterPro:IPR002187 LENGTH 126 SQ:AASEQ MKEIIAIIRMNKVNVTKKALSEIGVCGLHAMKVMGRGKMKVDFYIINELGNKEEIGGILADGLSEGARLIPKRLLTILVHDDEVEKVVGAIIEVNKEGHKGDGKIFVGPVLGAVRVRTGEQGEIAI GT:EXON 1|1-126:0| BL:SWS:NREP 1 BL:SWS:REP 1->126|GLNB2_METBA|2e-24|48.7|117/123| PROS 27->37|PS00639|THIOL_PROTEASE_HIS|PDOC00126| BL:PDB:NREP 1 BL:PDB:REP 1->126|2gw8A|5e-16|44.9|98/99| RP:PDB:NREP 1 RP:PDB:REP 1->126|3bzqA|1e-20|39.2|97/99| RP:PFM:NREP 1 RP:PFM:REP 6->119|PF00543|4e-11|48.0|100/102|P-II| HM:PFM:NREP 1 HM:PFM:REP 4->119|PF00543|2.6e-30|51.0|100/102|P-II| GO:PFM:NREP 2 GO:PFM GO:0006808|"GO:regulation of nitrogen utilization"|PF00543|IPR002187| GO:PFM GO:0030234|"GO:enzyme regulator activity"|PF00543|IPR002187| RP:SCP:NREP 1 RP:SCP:REP 1->126|1gnkA|5e-17|35.7|98/98|d.58.5.1| HM:SCP:REP 1->126|1gnkA_|8.2e-28|51.8|110/0|d.58.5.1|1/1|GlnB-like| OP:NHOMO 800 OP:NHOMOORG 524 OP:PATTERN -----------------------11----2--12312154544631111-3311---1---------- 121-11-1111-1-----------------------------------1---1121----1-----1111-1111111--1---12-1--111----------11-1------------------22112122122-----112-1112-111--11-----1--1111----11-----111---111--1-----------------------------11---------1-------------------------------------------111--------11-----------------------------------1-12------------22------1---314233331---1311-3---1212222-1-11212223123323211111111111-22122222121-2221222222122122122122222222222222212212212------------------------------2122-2222211111112222112222222211222221122232122221111-122322221111111--12321332212-121113-2222122121221-1111--1----------------1222-22232212222121111121222221211213---1222------11222121111111111-1111111111111111111111222221111111111111111211111111-222122222222---1-----1111121221111111111111111111111---121111----1----1------------32222222222222211221221111111112-11---------------------------------------------1-11114- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------122-1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 100.0 SQ:SECSTR EEEEEEEEcGGGHHHHHHHHHHTTccccEEEEEEEEccccccEEcccEETccccccccHHHTTcccccEEEEEEEEEEEETTTHHHHHHHHHHHHccccTTccEEEEEEEcccccTTTcccGGGGc DISOP:02AL 121-127| PSIPRED cEEEEEEEcHHHHHHHHHHHHHccccEEEEEEEEEcccccccHHHcccccccccccccEEcccEEEEEEEEEEEEEEEEcHHHHHHHHHHHHHHcccccccccEEEEEEcccEEEEcccccccccc //