[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51327.1
DDBJ      :             2-oxoglutarate ferredoxin oxidoreductase, gamma subunit
Swiss-Prot:             

Homologs  Archaea  38/68 : Bacteria  88/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.64.1
:187 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->184 3g2eB PDBj 1e-06 24.2 %
:RPS:SCOP  4->187 1b0pA4  c.64.1.1 * 7e-13 17.4 %
:HMM:SCOP  3->187 1b0pA4 c.64.1.1 * 5.1e-33 30.3 %
:RPS:PFM   13->182 PF01558 * POR 6e-14 37.0 %
:HMM:PFM   13->184 PF01558 * POR 1.6e-38 30.5 167/173  
:BLT:SWISS 9->184 VORA_METTH 4e-18 32.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51327.1 GT:GENE ABO51327.1 GT:PRODUCT 2-oxoglutarate ferredoxin oxidoreductase, gamma subunit GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3063404..3063967) GB:FROM 3063404 GB:TO 3063967 GB:DIRECTION - GB:PRODUCT 2-oxoglutarate ferredoxin oxidoreductase, gamma subunit GB:NOTE TIGRFAM: pyruvate/ketoisovalerate oxidoreductase, gamma subunit PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase KEGG: chy:CHY_0045 putative keto/oxoacid ferredoxin oxidoreductase, gamma subunit GB:PROTEIN_ID ABO51327.1 GB:DB_XREF GI:134053356 InterPro:IPR002869 InterPro:IPR011894 LENGTH 187 SQ:AASEQ MAKAVKICLAGEGGQGVQSVAGIIADAANAEGREALYIPNFGVEQRGGVSIAFLQIADKPIGAPKFDKADILVTLSDRAVRRCKQYVDANTVFVYDASIQGVEEDLPKEGEAKKVLAIPALEISQNELHPRVFNILIMGAVIGATGVIPVETAKAAIEKKLGYKFEQNPQLRELNFKAIDRGIELMK GT:EXON 1|1-187:0| BL:SWS:NREP 1 BL:SWS:REP 9->184|VORA_METTH|4e-18|32.1|165/477| TM:NTM 1 TM:REGION 129->151| BL:PDB:NREP 1 BL:PDB:REP 11->184|3g2eB|1e-06|24.2|165/185| RP:PFM:NREP 1 RP:PFM:REP 13->182|PF01558|6e-14|37.0|165/178|POR| HM:PFM:NREP 1 HM:PFM:REP 13->184|PF01558|1.6e-38|30.5|167/173|POR| GO:PFM:NREP 2 GO:PFM GO:0016903|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors"|PF01558|IPR019752| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01558|IPR019752| RP:SCP:NREP 1 RP:SCP:REP 4->187|1b0pA4|7e-13|17.4|184/253|c.64.1.1| HM:SCP:REP 3->187|1b0pA4|5.1e-33|30.3|185/253|c.64.1.1|1/1|Pyruvate-ferredoxin oxidoreductase, PFOR, domain III| OP:NHOMO 199 OP:NHOMOORG 126 OP:PATTERN --12---------------121221--11---312122111121-11-1121211321323---1--- -21----------------------------------------------------------------------------11---12-211111211-------------------------------------1-----11111--------------------------------------------1-1------------------------------------------------------------------------------------------------------------------------------------132---1--111---13-------11--1--12---222123211313---1--------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------1----------------1---221-1111222211222122221--1----4----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------3223323232--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 182 STR:RPRED 97.3 SQ:SECSTR ###cccccccccccccTTHHHHHHHHHHHHTTcEEEEEEccccccccccccEEEEEEcccccccccTcEEEEEEccHHHHHHHGGGEEEEEEEEEcTTTccccTTHHHHcEccEEEEccHHHHHHHTTcGGGHHHHHHHHHHHHHccccHHHHHHHHHHHccGGccH##HGHHHHHHHHHHHHHHcE DISOP:02AL 1-1| PSIPRED ccccEEEEEEEccccHHHHHHHHHHHHHHHccccEEEEEcccHHHcccEEEEEEEEccccccccccccccEEEEEcHHHHHHHHccccccEEEEEcccccccHHHHcccccccEEEEEcHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcc //