[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51336.1
DDBJ      :             dihydrolipoamide dehydrogenase
Swiss-Prot:             

Homologs  Archaea  65/68 : Bacteria  869/915 : Eukaryota  194/199 : Viruses  0/175   --->[See Alignment]
c.3.1d.166.1d.87.1
:463 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   36->458 1lpfA PDBj 2e-78 35.9 %
:RPS:PDB   35->450 1dncA PDBj 2e-69 25.9 %
:RPS:SCOP  35->92 2auaA1  d.166.1.6 * 1e-08 12.1 %
:RPS:SCOP  138->341 1gv4A1  c.3.1.5 * 2e-21 13.6 %
:RPS:SCOP  340->454 1aogA3  d.87.1.1 * 3e-37 29.6 %
:HMM:SCOP  1->337 1gpeA1 c.3.1.2 * 4.6e-64 32.9 %
:HMM:SCOP  340->462 1aogA3 d.87.1.1 * 4.3e-39 55.3 %
:RPS:PFM   40->315 PF07992 * Pyr_redox_2 2e-11 35.9 %
:RPS:PFM   344->452 PF02852 * Pyr_redox_dim 3e-29 56.9 %
:HMM:PFM   7->314 PF07992 * Pyr_redox_2 9.6e-54 47.2 195/202  
:HMM:PFM   344->453 PF02852 * Pyr_redox_dim 2.9e-41 51.8 110/110  
:BLT:SWISS 35->453 DLDH2_BACSU 5e-91 44.6 %
:PROS 40->50|PS00076|PYRIDINE_REDOX_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51336.1 GT:GENE ABO51336.1 GT:PRODUCT dihydrolipoamide dehydrogenase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3072846..3074237) GB:FROM 3072846 GB:TO 3074237 GB:DIRECTION - GB:PRODUCT dihydrolipoamide dehydrogenase GB:NOTE TIGRFAM: dihydrolipoamide dehydrogenase PFAM: FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glucose-inhibited division protein A; pyridine nucleotide-disulphide oxidoreductase dimerisation region; HI0933 family protein KEGG: chy:CHY_0713 alpha keto acid dehydrogenase complex, E3 component, lipoamide dehydrogenase GB:PROTEIN_ID ABO51336.1 GB:DB_XREF GI:134053365 InterPro:IPR000103 InterPro:IPR000815 InterPro:IPR001100 InterPro:IPR001327 InterPro:IPR002218 InterPro:IPR004099 InterPro:IPR004792 InterPro:IPR006258 InterPro:IPR012999 InterPro:IPR013027 LENGTH 463 SQ:AASEQ MTNETFDVVVIGGGPGGYTAAARAAALGGRVALVEKEALGGTCLNQGCIPTKTLLKSTEVLETVKKAKDFGVEVGVPEVALEKLINRKQAVIKRLNTGVEFLMKSGKISVFQGEGKITGANEITVSNPSKQVILRTQKIIIATGSRPAVIPGLETDGEKIINSNHALMLSDVPGSLLIIGGGAIGVEFASIYHKLGAKVTLVEAMDRILPFADEEVSNGLKQLMTREKISILTSAKVSGVNNSEEGLLVNVDTPKGIQEFRVDKVLVAVGRRPNVENLGLEEIGIQIERGRIVVNTYMETNVPNIYAVGDATGGILLAHVASTEGIVAAANAMGGHKEMDYAVVPSCIYTSPELASVGITEAQAKEQGIQVVVGKSQFTGSGKALAMGENKGLVKIIADVENGKILGVHILGPQATSLISEATLAIKLGATAEDMAETIHAHPSLPETVMEAAEQVVGLLKTI GT:EXON 1|1-463:0| BL:SWS:NREP 1 BL:SWS:REP 35->453|DLDH2_BACSU|5e-91|44.6|419/474| PROS 40->50|PS00076|PYRIDINE_REDOX_1|PDOC00073| SEG 8->34|vvvigggpggytaaaraaalggrvalv| SEG 178->185|iigggaig| SEG 278->292|lgleeigiqiergri| BL:PDB:NREP 1 BL:PDB:REP 36->458|1lpfA|2e-78|35.9|423/472| RP:PDB:NREP 1 RP:PDB:REP 35->450|1dncA|2e-69|25.9|413/460| RP:PFM:NREP 2 RP:PFM:REP 40->315|PF07992|2e-11|35.9|234/275|Pyr_redox_2| RP:PFM:REP 344->452|PF02852|3e-29|56.9|109/110|Pyr_redox_dim| HM:PFM:NREP 2 HM:PFM:REP 7->314|PF07992|9.6e-54|47.2|195/202|Pyr_redox_2| HM:PFM:REP 344->453|PF02852|2.9e-41|51.8|110/110|Pyr_redox_dim| GO:PFM:NREP 5 GO:PFM GO:0005737|"GO:cytoplasm"|PF02852|IPR004099| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF02852|IPR004099| GO:PFM GO:0045454|"GO:cell redox homeostasis"|PF02852|IPR004099| GO:PFM GO:0050660|"GO:FAD binding"|PF02852|IPR004099| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02852|IPR004099| RP:SCP:NREP 3 RP:SCP:REP 35->92|2auaA1|1e-08|12.1|58/192|d.166.1.6| RP:SCP:REP 138->341|1gv4A1|2e-21|13.6|199/224|c.3.1.5| RP:SCP:REP 340->454|1aogA3|3e-37|29.6|115/130|d.87.1.1| HM:SCP:REP 1->337|1gpeA1|4.6e-64|32.9|325/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| HM:SCP:REP 340->462|1aogA3|4.3e-39|55.3|123/130|d.87.1.1|1/1|FAD/NAD-linked reductases, dimerisation (C-terminal) domain| OP:NHOMO 4047 OP:NHOMOORG 1128 OP:PATTERN 22111153555565662332311341121351222111111112212111332122322223441--- 4445743344533394555-7611865555535444378634454535455256944433559464565321111222--113131114441-411122222273332321111111111111131312221222232212111224444444123322222322245474222222222222322442211334444444424454444633434452324266644444552333333333333333856452515413222774423355662435644544455444443344444333333333333355444455533231-22222421311533-122311-13-1-131152224125543123215533433333356343343333344454444445-4454654667435554669776773A55555444445653333333353324343223222222211222222222222222221535724545867776864444663555553456647583245434366535452364311133333333346343225623432344222-324245342334344-3111-------------------213674437754535622222242422322223241-1764511111143334334445455544-4444455444454343444444333334444454444364445433333343144444444444411331111144542475522222222222222254445345543356675555455564433434445343344455555554545433443422222222232443333--------11222212-1-32111222132132---2211331323541 4411225-C55-2222222122223222222222212222222221333334432223222222222222222233323322222222-53222222222222425-39573744364424552CA1E2N*9-B6J3343A4565354525446387565AF35421533755854554*44445686A2848988679 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 429 STR:RPRED 92.7 SQ:SECSTR ##################################EcccTTHHHHHTcHHHHHHHHHHHHHHHHHHHTGGGTcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHTTcEEEEcccEEccccccEEEETTEEETTEccEEEEcccEEEccccTTTcTTGGcccHHHHTTccccccEEEEEcccHHHHHHHHHHHHTTcEEEEEcccccccTTccHHHHHHHHHHHHHTTcEEETTEEEEEEEEccccEEEEEEEccTTEEEEEcEEEEcccEEEccTTccGGGGTccccTTcccccTTcccccTTEEEccGGGcccccHHHHHHHHHHHHHHHHccTcccccccccEEEcccccEEEEEccHHHHHHHHcGEEEEEEEEccGGGGGccccccEEEEEEEETTTTEEEEEEEEcTTHHHHHHHHHHHHHTTccHHHHHTccccccccGGGGGHHHHHHHTccccc DISOP:02AL 1-1| PSIPRED cccccccEEEEcccHHHHHHHHHHHHcccEEEEEEccccccEEEEEccccHHHHHHHHHHHHHHHHcccccEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEccccEEEEEEcccEEEEEEccEEEcccccccccccccccccEEEEHHHHHcHHHcccEEEEEcccHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHHcccEEEcccEEEEEEEcccEEEEEEEccccEEEEEEcEEEEEccEEEccccccHHHccEEEEccEEEEccEEEcccccEEEcccccccccccHHHHHHHHHHHHHHcccccccccccEEEEEEEcccEEEEEccHHHHHHccccEEEEEEEccccccEEccccccEEEEEEEEccccEEEEEEEEcccHHHHHHHHHHHHHccccHHHHHccccccccHHHHHHHHHHHHHHHHccc //