[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51341.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:182 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   14->171 PF03845 * Spore_permease 8e-06 29.3 %
:HMM:PFM   4->174 PF03845 * Spore_permease 6.3e-25 24.1 170/320  
:BLT:SWISS 21->180 GERKB_BACSU 5e-17 29.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51341.1 GT:GENE ABO51341.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 3079322..3079870 GB:FROM 3079322 GB:TO 3079870 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: swo:Swol_1192 hypothetical protein GB:PROTEIN_ID ABO51341.1 GB:DB_XREF GI:134053370 LENGTH 182 SQ:AASEQ MLCLIYFWMAVHSVVFLFKDMDFSNLLPIFDLPLKDFLQSVHSTATFPFGETIAFLMIFPFVKKTGNLTKHVLIFMFIAGIFISLVAIRDITALGPMAEIESFPPYRTVRLIDIANIITRMEILLAISFLLVGVIKIFVLFYGGTLGLAQLFKLKAYLPLVYPLGAIITLMSLVNFNSYLGV GT:EXON 1|1-182:0| BL:SWS:NREP 1 BL:SWS:REP 21->180|GERKB_BACSU|5e-17|29.4|160/373| TM:NTM 5 TM:REGION 6->28| TM:REGION 41->62| TM:REGION 69->91| TM:REGION 119->141| TM:REGION 158->180| RP:PFM:NREP 1 RP:PFM:REP 14->171|PF03845|8e-06|29.3|157/319|Spore_permease| HM:PFM:NREP 1 HM:PFM:REP 4->174|PF03845|6.3e-25|24.1|170/320|Spore_permease| GO:PFM:NREP 2 GO:PFM GO:0009847|"GO:spore germination"|PF03845|IPR004761| GO:PFM GO:0016021|"GO:integral to membrane"|PF03845|IPR004761| OP:NHOMO 42 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------12-------2---1---111----------32-------------------------------------------------------------------------------------------213-----------1--------1------1-222311-1-211------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 182-183| PSIPRED cHHHHHHHHHHHHHHHHcccccHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccc //