[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51345.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:152 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   94->135 PF10463 * Peptidase_U49 1.5e-05 35.7 42/206  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51345.1 GT:GENE ABO51345.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3082345..3082803) GB:FROM 3082345 GB:TO 3082803 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO51345.1 GB:DB_XREF GI:134053374 LENGTH 152 SQ:AASEQ MLILNNENYITNKQIKSIIKILGPDYRPGKIVIYESRLDILKFFPKCFNFSLEEFMGKLEGSYDVQSDVAYLCIFAQTDDGDDFHSKQLYSLHALVHELRHRYQFENNFLTEDDEASEIDADKFATHFINSNSARISKIMNWQEEWTIEEED GT:EXON 1|1-152:0| HM:PFM:NREP 1 HM:PFM:REP 94->135|PF10463|1.5e-05|35.7|42/206|Peptidase_U49| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 149-153| PSIPRED cEEEcccccccHHHHHHHHHHHcccccccEEEEEHHHHHHHHHHHHHHcccHHHHHHHccccccccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHccHHHHHHHHHcccHHHHHHHHcHHHHccccccc //