[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51350.1
DDBJ      :             MIP family channel protein
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  507/915 : Eukaryota  152/199 : Viruses  0/175   --->[See Alignment]
f.19.1
:236 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->206 1fx8A PDBj 2e-19 43.9 %
:RPS:PDB   44->102 2b5fD PDBj 7e-16 30.5 %
:RPS:PDB   56->75,180->213 3cllA PDBj 1e-08 43.5 %
:RPS:SCOP  5->235 1fx8A  f.19.1.1 * 4e-35 32.0 %
:HMM:SCOP  1->238 1fx8A_ f.19.1.1 * 2.5e-70 43.8 %
:RPS:PFM   4->213 PF00230 * MIP 2e-35 51.3 %
:HMM:PFM   4->230 PF00230 * MIP 3.8e-51 34.3 210/227  
:BLT:SWISS 1->213 GLPF_THEMA 4e-83 64.8 %
:PROS 62->70|PS00221|MIP
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51350.1 GT:GENE ABO51350.1 GT:PRODUCT MIP family channel protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3088991..3089701) GB:FROM 3088991 GB:TO 3089701 GB:DIRECTION - GB:PRODUCT MIP family channel protein GB:NOTE TIGRFAM: MIP family channel proteins PFAM: major intrinsic protein KEGG: btl:BALH_0917 glycerol uptake facilitator protein GB:PROTEIN_ID ABO51350.1 GB:DB_XREF GI:134053379 InterPro:IPR000425 InterPro:IPR012269 LENGTH 236 SQ:AASEQ MTPFLAEIIGTMILIILGDGVVAGVLLKKSKAENSGWIVITAGWGLAVAMAVYAVGGFSGAHLNPAVTIGLAAIGSFPWADVPSYILAQFIGAFLGGVIVWLHYLPHWKETNDPGAKLGIFCTGPGIRDNFGNLVSEIIGTFILVLGILAIGANKFADGINPFIVGLLIVSIGLSLGGTTGYAINPARDLGPRIAHAVLPIAGKGNSDWGYSWIPVVGPVIGGVLGALFYKAFFLA GT:EXON 1|1-236:0| BL:SWS:NREP 1 BL:SWS:REP 1->213|GLPF_THEMA|4e-83|64.8|213/234| PROS 62->70|PS00221|MIP|PDOC00193| TM:NTM 5 TM:REGION 5->27| TM:REGION 37->59| TM:REGION 84->105| TM:REGION 143->165| TM:REGION 213->235| SEG 164->178|ivgllivsiglslgg| SEG 214->226|ipvvgpviggvlg| BL:PDB:NREP 1 BL:PDB:REP 5->206|1fx8A|2e-19|43.9|196/254| RP:PDB:NREP 2 RP:PDB:REP 44->102|2b5fD|7e-16|30.5|59/230| RP:PDB:REP 56->75,180->213|3cllA|1e-08|43.5|43/241| RP:PFM:NREP 1 RP:PFM:REP 4->213|PF00230|2e-35|51.3|199/227|MIP| HM:PFM:NREP 1 HM:PFM:REP 4->230|PF00230|3.8e-51|34.3|210/227|MIP| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00230|IPR000425| GO:PFM GO:0006810|"GO:transport"|PF00230|IPR000425| GO:PFM GO:0016020|"GO:membrane"|PF00230|IPR000425| RP:SCP:NREP 1 RP:SCP:REP 5->235|1fx8A|4e-35|32.0|228/254|f.19.1.1| HM:SCP:REP 1->238|1fx8A_|2.5e-70|43.8|235/254|f.19.1.1|1/1|Aquaporin-like| OP:NHOMO 1468 OP:NHOMOORG 682 OP:PATTERN -------1-111111--------1---1----121---11111111-11--1---------------- 1221211-----1-2----------3-------1111211----21111111111112--11-11-2322-1111111---11-------1--1----------11-1-2--------------111--1------11111----1----1------------11-1----------------211----1--111111121111211111111111111111212222221-111111111111111111133231221111155112243422144333331123113333333333323223222322323331113333---211111111212----2222-1-11---1----1----1-211--1-2-2---------2-1---1-1-1----1-----1---1121111111---22--------111-1-1-11111--1111111111221------------------------------------21--11--22222212222223-222222222---1----------1---1--1--11-2---------------------1-11111-1-11--------1-------------------------------2221-----1------------1--111-1--1-------11112111111111111121-1111111111112111112222112212222222222222212111111131-111111111111------------------111212-12-21--1111111----2-11211121-22211111111111111-2222-1111221111111111---1111---111111111111111---------1-1111111111111-----------1----- 11--11--313-22254223223434211-1-1111111111111142232212222-----2--112--21-1-22-121--------5214114----2-2122-23-DBC8C822415553B76B5Fe7-8691554736653644353256659811-4646-4-165851-11-----22C9LN1JC--MGTU- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 210 STR:RPRED 89.0 SQ:SECSTR ###HHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHTTTTcccccHHHHHHHHHHcHHHHHHTTHHHHHHHHHHHHHHHHHHHHcHHHHHHHHTTTTcccccTTccHHHHHHHHHHHHHHHHHHHHTEEEEEEcTTccEEEcHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcTTTHHcHHHH####################### PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcc //