[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51354.1
DDBJ      :             diguanylate cyclase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  645/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
d.58.29
:135 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->125 1w25A PDBj 2e-26 47.5 %
:RPS:PDB   1->127 3breB PDBj 9e-31 38.6 %
:RPS:SCOP  1->127 1w25A3  d.58.29.2 * 6e-32 42.5 %
:HMM:SCOP  1->131 1w25A3 d.58.29.2 * 2.5e-42 44.2 %
:RPS:PFM   1->123 PF00990 * GGDEF 8e-29 49.6 %
:HMM:PFM   1->124 PF00990 * GGDEF 8.2e-40 41.9 124/161  
:BLT:SWISS 1->125 PLED_CAUCR 6e-26 47.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51354.1 GT:GENE ABO51354.1 GT:PRODUCT diguanylate cyclase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3092848..3093255) GB:FROM 3092848 GB:TO 3093255 GB:DIRECTION - GB:PRODUCT diguanylate cyclase GB:NOTE TIGRFAM: diguanylate cyclase PFAM: GGDEF domain containing protein KEGG: gme:Gmet_2721 diguanylate cyclase (GGDEF domain) with GAF sensor GB:PROTEIN_ID ABO51354.1 GB:DB_XREF GI:134053383 InterPro:IPR000160 LENGTH 135 SQ:AASEQ MMDIDYFKTFNDTLGHLAGDRLLKELANILTLAVRDEDMVARYGGDEFVVILKDTHVARSHDVAERIRVNIANHPFEGRECLPCGRVTVSMGVAVFPVHGQTVEEIIRSADNALYKAKKSSRNKIEFSQSSPLVS GT:EXON 1|1-135:0| BL:SWS:NREP 1 BL:SWS:REP 1->125|PLED_CAUCR|6e-26|47.5|122/454| BL:PDB:NREP 1 BL:PDB:REP 1->125|1w25A|2e-26|47.5|122/454| RP:PDB:NREP 1 RP:PDB:REP 1->127|3breB|9e-31|38.6|127/328| RP:PFM:NREP 1 RP:PFM:REP 1->123|PF00990|8e-29|49.6|119/160|GGDEF| HM:PFM:NREP 1 HM:PFM:REP 1->124|PF00990|8.2e-40|41.9|124/161|GGDEF| RP:SCP:NREP 1 RP:SCP:REP 1->127|1w25A3|6e-32|42.5|127/162|d.58.29.2| HM:SCP:REP 1->131|1w25A3|2.5e-42|44.2|129/0|d.58.29.2|1/1|Nucleotide cyclase| OP:NHOMO 8071 OP:NHOMOORG 654 OP:PATTERN -------------------------------------------------------------------- G9328---111---14211-1D22--11111-A4445964BAANd-------535-----983-B2H5553---------A168CJ66--------------------1----------------11111111151BCC8911194kTRDJJ123EE---2--9H9-DDI3------------N6A549816A2777775672777777-33333777487D1EF333333AC11111111111111111111--2--------22---1--1-11-----------------------------------------------3DB8J88888888793F775455958--7BB59IHGD6759A521452--C386992-----25VOR86GWNIPU4677467667H-URGQQ7LKAT5-HQQOUULUUYGDQG7B9282AC89764--------CCC3-hAP11111111111111111111111-11111-56C8299842GEGFIFD7776DDUX777727HQOCNFN-2NMHWGZJNS12o97TSTTIYZXK-------36FKfo4IRGJIMP8jRLJM1KILZHMGYQ6666B665E556-11111----------TAIOF43WTGaeXmKkUgogghfhmbiffWdabUVvo---BWDg------9EHC3G7CCCBCBBBDA-ACBDC78BCBBABBCCBBCDGCDE---7388777777787886C7764368--E34444433444---R-----FHGGG9jCl---------------9899938-1-GYOOONWWXWWWVUSPRTW-----1---XPSSPVVUUTVYVkkLNHJKJHBCC1111--Z29966DD--111111517-------------------------A73C789868-1- ----1------------------------------------------------------------------------------------------1--------------------------------------------------------------2----4---------62----------1--7-----6---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 98.5 SQ:SECSTR EEEETTHHHHHHHHHHHHHHHHHHHHHHHHHHcccTTcEEEEccccEEEEEEETccHHHHHHHHHHHHHHHHTTccEEccccTTEEccEEEEEEEEccccccHHHHHHHHHHHHHHHHTTTcccEEEEEEccH## DISOP:02AL 134-136| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEccEEEEEEEccccHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEcccccccc //