[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51367.1
DDBJ      :             nitrogen regulatory protein P-II
Swiss-Prot:             

Homologs  Archaea  38/68 : Bacteria  593/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
d.58.5
:112 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->112 1qy7A PDBj 7e-35 58.0 %
:RPS:PDB   1->112 2eg1A PDBj 2e-29 60.0 %
:RPS:SCOP  1->112 1gnkA  d.58.5.1 * 5e-26 43.9 %
:HMM:SCOP  1->112 1gnkA_ d.58.5.1 * 3.5e-42 58.0 %
:RPS:PFM   4->105 PF00543 * P-II 2e-27 57.8 %
:HMM:PFM   4->105 PF00543 * P-II 4.6e-43 63.7 102/102  
:BLT:SWISS 1->112 GLNB_FREDI 6e-35 59.8 %
:PROS 83->96|PS00638|PII_GLNB_CTER

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51367.1 GT:GENE ABO51367.1 GT:PRODUCT nitrogen regulatory protein P-II GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3108830..3109168) GB:FROM 3108830 GB:TO 3109168 GB:DIRECTION - GB:PRODUCT nitrogen regulatory protein P-II GB:NOTE PFAM: nitrogen regulatory protein P-II KEGG: dsy:DSY4258 hypothetical protein GB:PROTEIN_ID ABO51367.1 GB:DB_XREF GI:134053396 InterPro:IPR002187 LENGTH 112 SQ:AASEQ MKKIEAIIRPSKLEEIKKVLDKYGIKGMTVSQVMGCGNQKGRVNVYRGQEYTINLLPKIKVEIILTDLRVEEVVDQIVRTARTGEVGDGKIFIYPVENAIRIRTGDSGSEAL GT:EXON 1|1-112:0| BL:SWS:NREP 1 BL:SWS:REP 1->112|GLNB_FREDI|6e-35|59.8|112/112| PROS 83->96|PS00638|PII_GLNB_CTER|PDOC00439| BL:PDB:NREP 1 BL:PDB:REP 1->112|1qy7A|7e-35|58.0|112/112| RP:PDB:NREP 1 RP:PDB:REP 1->112|2eg1A|2e-29|60.0|95/95| RP:PFM:NREP 1 RP:PFM:REP 4->105|PF00543|2e-27|57.8|102/102|P-II| HM:PFM:NREP 1 HM:PFM:REP 4->105|PF00543|4.6e-43|63.7|102/102|P-II| GO:PFM:NREP 2 GO:PFM GO:0006808|"GO:regulation of nitrogen utilization"|PF00543|IPR002187| GO:PFM GO:0030234|"GO:enzyme regulator activity"|PF00543|IPR002187| RP:SCP:NREP 1 RP:SCP:REP 1->112|1gnkA|5e-26|43.9|98/98|d.58.5.1| HM:SCP:REP 1->112|1gnkA_|3.5e-42|58.0|112/0|d.58.5.1|1/1|GlnB-like| OP:NHOMO 1154 OP:NHOMOORG 642 OP:PATTERN ---1---------------1-1131--113111241235566442112117841---1111------1 122-211111111-11111-11--1111111111111111122211--1---1121-1--111-1-1211-1111111--1--22222--112----------21-3-1----------------34232333233-----113-12121111111111111111121111111111111111211111--1-1-----------------2211------11--111111-1-------------------------------------------111--------11---------------------------111----12-12------------44------1---314344331---1311-4---1243333-1111233333223333311111111111-22222222223-2222222222222222122122222222222222213312223------------------------------2222122222222222222222222222222222222212222322232222222322434221111111--123214322222132332-2223242222222-1132--1----------------1222244232212222222333322233332322323---1222------22222222222222222-2222222222222222222222222222222222222222222222222222-222222222222---1-----11113212211111111111111111111111111211111111111111111---------32222222222222222222222221111222-221111--------------------------------------1--1-11114- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1117---1-1122-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEcGGGHHHHHHHHHHTTccccEEEEEEEccccETTccccTTHHHHHHcEEEEEEEEEEcGGGHHHHHHHHHHHHccccTTccEEEEEEccccccTTTcccGGGTc DISOP:02AL 107-113| PSIPRED cEEEEEEEcHHHHHHHHHHHHHccccEEEEEEEEEccccccEEEEEEEEEEEEEEEEEEEEEEEEcHHHHHHHHHHHHHHcccccccccEEEEEEcccEEEEEccccccccc //