[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51372.1
DDBJ      :             holo-acyl-carrier-protein synthase
Swiss-Prot:ACPS_DESRM   RecName: Full=Holo-[acyl-carrier-protein] synthase;         Short=Holo-ACP synthase;         EC=2.7.8.7;AltName: Full=4'-phosphopantetheinyl transferase acpS;

Homologs  Archaea  1/68 : Bacteria  419/915 : Eukaryota  26/199 : Viruses  0/175   --->[See Alignment]
d.150.1
:125 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->109 3h88X PDBj 3e-18 45.8 %
:RPS:PDB   3->110 2bddA PDBj 2e-24 35.0 %
:RPS:SCOP  3->110 1f7lA  d.150.1.2 * 5e-21 40.4 %
:HMM:SCOP  1->118 1fthA_ d.150.1.2 * 5.5e-24 47.2 %
:RPS:PFM   4->63 PF01648 * ACPS 1e-06 50.9 %
:HMM:PFM   4->65 PF01648 * ACPS 1.6e-18 41.9 62/70  
:BLT:SWISS 1->125 ACPS_DESRM 6e-63 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51372.1 GT:GENE ABO51372.1 GT:PRODUCT holo-acyl-carrier-protein synthase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3114235..3114612) GB:FROM 3114235 GB:TO 3114612 GB:DIRECTION - GB:PRODUCT holo-acyl-carrier-protein synthase GB:NOTE TIGRFAM: holo-acyl-carrier-protein synthase PFAM: 4'-phosphopantetheinyl transferase KEGG: sth:STH2938 holo-(acyl-carrier-protein) synthase GB:PROTEIN_ID ABO51372.1 GB:DB_XREF GI:134053401 InterPro:IPR002582 InterPro:IPR004568 InterPro:IPR008278 LENGTH 125 SQ:AASEQ MKGIGTDIIEIERIELAVSRSGQQFLDRVFTAAEQEHCQGKVHSLAGRFAAKEAVLKALGTGLREMRWTNIEILPNHLGKPEVTLSGPALERAEKEGIHRILVSIAHDRGRAVAFAVAVGKEKEG GT:EXON 1|1-125:0| SW:ID ACPS_DESRM SW:DE RecName: Full=Holo-[acyl-carrier-protein] synthase; Short=Holo-ACP synthase; EC=2.7.8.7;AltName: Full=4'-phosphopantetheinyl transferase acpS; SW:GN Name=acpS; OrderedLocusNames=Dred_2868; SW:KW Complete proteome; Cytoplasm; Fatty acid biosynthesis;Lipid synthesis; Magnesium; Metal-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->125|ACPS_DESRM|6e-63|100.0|125/125| GO:SWS:NREP 5 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006633|"GO:fatty acid biosynthetic process"|Fatty acid biosynthesis| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 112->119|avafavav| BL:PDB:NREP 1 BL:PDB:REP 3->109|3h88X|3e-18|45.8|107/124| RP:PDB:NREP 1 RP:PDB:REP 3->110|2bddA|2e-24|35.0|103/127| RP:PFM:NREP 1 RP:PFM:REP 4->63|PF01648|1e-06|50.9|57/67|ACPS| HM:PFM:NREP 1 HM:PFM:REP 4->65|PF01648|1.6e-18|41.9|62/70|ACPS| GO:PFM:NREP 3 GO:PFM GO:0000287|"GO:magnesium ion binding"|PF01648|IPR008278| GO:PFM GO:0008897|"GO:holo-[acyl-carrier-protein] synthase activity"|PF01648|IPR008278| GO:PFM GO:0009059|"GO:macromolecule biosynthetic process"|PF01648|IPR008278| RP:SCP:NREP 1 RP:SCP:REP 3->110|1f7lA|5e-21|40.4|99/118|d.150.1.2| HM:SCP:REP 1->118|1fthA_|5.5e-24|47.2|108/117|d.150.1.2|1/1|4'-phosphopantetheinyl transferase| OP:NHOMO 453 OP:NHOMOORG 446 OP:PATTERN -------------------------------------------1------------------------ --11--------------------------------11-1-----------1---1----------------------1111-1-1-1-----------------11---1------1111111111111-11111---1111111--------------------1---------------------111-1111111-111111--1-1--1111-1-1111111111111-11111111111111-11-11------1---1111111----1-------------11111111111-----------------------1111-11111111111111111111------1111111111-11111-11-11111-1-111111111111111111111111111-11-11-1-1-11111-11111111111111111111111--------11111-1----11-----111----1-11-11--1---1-1--1---11--2-11----111------1-111--1-1111111---1111111--------------1-1--------11-1--11--111111111-----111----111111-1-1111-11-1-11-----1---1---1------------------1------------11111111221111111-21-1111111211111111111111121111111111111111111111111-1111111111111--1-------------1-----------------------------------------------------111111111111111----------------1-111111--------1------------------------------1-------1- -----1--------------11--1-1-------1------------1---------11111111-----1-1-1-----1--1--1---11-1-1-------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 86.4 SQ:SECSTR ##EEEEEEEEHHHHHHHHHHcTTHHHHHHccHHHHHHHHTHHHHHHHHHHHHHHHHHHTTcccccGGGGGEEEEEcTTccEEEEEcHHHHHHHHHHTccEEEEEEEEEcc############### DISOP:02AL 123-126| PSIPRED cEEEEEEEEEHHHHHHHHHHccHHHHHHHccHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccEEEEEcHHHHHHHHHccccEEEEEEEEcccEEEEEEEEEEccccc //