[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51376.1
DDBJ      :             methyl-accepting chemotaxis sensory transducer
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  64/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.138.1h.4.5
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->81 2ch7A PDBj 1e-09 26.6 %
:RPS:PDB   1->64 3ebhA PDBj 7e-10 12.5 %
:RPS:SCOP  4->84 1oahA  a.138.1.3 * 2e-07 13.6 %
:HMM:SCOP  2->126 2ch7B1 h.4.5.1 * 7.8e-21 36.1 %
:HMM:PFM   2->126 PF00015 * MCPsignal 3.2e-22 34.4 125/213  
:BLT:SWISS 1->126 TLPB_BACSU 3e-10 32.5 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51376.1 GT:GENE ABO51376.1 GT:PRODUCT methyl-accepting chemotaxis sensory transducer GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3118841..3119221) GB:FROM 3118841 GB:TO 3119221 GB:DIRECTION - GB:PRODUCT methyl-accepting chemotaxis sensory transducer GB:NOTE PFAM: chemotaxis sensory transducer KEGG: swo:Swol_0365 putative methyl-accepting chemotaxis sensory transducer GB:PROTEIN_ID ABO51376.1 GB:DB_XREF GI:134053405 InterPro:IPR004089 LENGTH 126 SQ:AASEQ MAEEVRKLAEQSANSTKEIANIIGEVHSEMQKANQKMDEAALEVEEGVRITNQSGTALNKIIEQIDESVESIKQIAEGVKQTSEGTQQLAAATQQVTSTVQQQTGTSQELAKMAEEFQEMVGQFKL GT:EXON 1|1-126:0| BL:SWS:NREP 1 BL:SWS:REP 1->126|TLPB_BACSU|3e-10|32.5|126/662| COIL:NAA 29 COIL:NSEG 1 COIL:REGION 65->93| SEG 85->108|gtqqlaaatqqvtstvqqqtgtsq| BL:PDB:NREP 1 BL:PDB:REP 3->81|2ch7A|1e-09|26.6|79/309| RP:PDB:NREP 1 RP:PDB:REP 1->64|3ebhA|7e-10|12.5|64/889| HM:PFM:NREP 1 HM:PFM:REP 2->126|PF00015|3.2e-22|34.4|125/213|MCPsignal| RP:SCP:NREP 1 RP:SCP:REP 4->84|1oahA|2e-07|13.6|81/475|a.138.1.3| HM:SCP:REP 2->126|2ch7B1|7.8e-21|36.1|122/0|h.4.5.1|1/1|Methyl-accepting chemotaxis protein (MCP) signaling domain| OP:NHOMO 125 OP:NHOMOORG 64 OP:PATTERN -------------------------------------------------------------------- -1----------------------------------------------------------------------------------------------------------2-------------------------1-----------------------------------------------------------222222-333-2221-1111-132-1-----------31-------------------------------------------------------------------------------------------1-12------------------1-2-----123458412--1--------3---------------------------------------------------------------------------------------------------------------------------------------------------------------------111---1-1-------1------------1--1---------11--2332343-31--1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 66.7 SQ:SECSTR HHHHHHHHHTTcHHHHHHTTGGGGGGGGccHHHHHHHHHHHHHHHTcTTccHHHHHHHHHHTTcHHHHHHHccEEEEEcTTccE########################################## DISOP:02AL 12-12,14-15,32-55,75-88,98-119| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //