[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51380.1
DDBJ      :             formate dehydrogenase family accessory protein FdhD
Swiss-Prot:             

Homologs  Archaea  39/68 : Bacteria  480/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.97.1
:262 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->261 2pw9D PDBj 5e-27 32.7 %
:RPS:SCOP  8->261 2pw9A1  c.97.1.5 * 3e-63 30.3 %
:RPS:PFM   30->260 PF02634 * FdhD-NarQ 2e-44 44.1 %
:HMM:PFM   28->260 PF02634 * FdhD-NarQ 2e-78 45.5 231/236  
:BLT:SWISS 7->261 FDHD_BACHD 6e-67 45.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51380.1 GT:GENE ABO51380.1 GT:PRODUCT formate dehydrogenase family accessory protein FdhD GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 3122717..3123505 GB:FROM 3122717 GB:TO 3123505 GB:DIRECTION + GB:PRODUCT formate dehydrogenase family accessory protein FdhD GB:NOTE TIGRFAM: formate dehydrogenase family accessory protein FdhD PFAM: formate dehydrogenase, subunit FdhD KEGG: bha:BH2527 required for formate dehydrogenase activity GB:PROTEIN_ID ABO51380.1 GB:DB_XREF GI:134053409 InterPro:IPR003786 LENGTH 262 SQ:AASEQ MVWQFNKTTSKIVRIKGDKIITTEDCIVREVPITLFLNDKEFVTMVCSPQALQELAVGFLCSEGLLQSPEDIKAIRLDEENGVVYIDAPDIEDESKFLKRNITSCCGRGRPVFYYINDAKSMNKVSSDLLVTPGQVWDLSDRLEEMSILFKETGGVHNAALCLPTEVMMFYEDVGRHNAVDKIFGRAFLDRIPLRDKILVFSGRVSSEIVIKIGKMGLPVIISRSAPTDLGLEMAQKLGITVVGFAKGERMNVYTYPERILG GT:EXON 1|1-262:0| BL:SWS:NREP 1 BL:SWS:REP 7->261|FDHD_BACHD|6e-67|45.1|255/270| BL:PDB:NREP 1 BL:PDB:REP 24->261|2pw9D|5e-27|32.7|217/237| RP:PFM:NREP 1 RP:PFM:REP 30->260|PF02634|2e-44|44.1|229/234|FdhD-NarQ| HM:PFM:NREP 1 HM:PFM:REP 28->260|PF02634|2e-78|45.5|231/236|FdhD-NarQ| GO:PFM:NREP 2 GO:PFM GO:0008863|"GO:formate dehydrogenase activity"|PF02634|IPR003786| GO:PFM GO:0009326|"GO:formate dehydrogenase complex"|PF02634|IPR003786| RP:SCP:NREP 1 RP:SCP:REP 8->261|2pw9A1|3e-63|30.3|228/231|c.97.1.5| OP:NHOMO 614 OP:NHOMOORG 521 OP:PATTERN ------11111111111--1-111--------2-1111111111212311111------1-111---- ---111-1111---11111-11--121111111111112111-11-11----1211-1----1-1121111--------1211----------------------1-1----------------------------11111---------11-----------------11------------11-11---1-12222222212222221111112211111---1111111-11111111111111112-11-----------------------------------------------------------------------11-1-----------1----------13--11111111-111-------11-111------113111-1111111111111--11-1111111111--11111111112111--1111111111111111111111-12-------------------------------1-11--111-22221221111122111111112113333-122221111-1112133--11111----------21--111111211111--313-2121---11113211---11111--1-------131--2222----3-1-111222-2222211221111-------------11111111111111111-1111111111111111111111111-1111111111111111111111111--111111111111-------------1--11111111111111--111111-1111--11-11121111112111----------111111111121111111111111------------------------------------------------------------11- -------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 237 STR:RPRED 90.5 SQ:SECSTR #######################EEEEEccEEEEEEETTEEEEEEEEccccHHHHHHHHHHHTTccccGGGEEEEEEETTTEEEEEccccHHccccccHHHHccccTTTEccccccccHHHHHHHHHHHHccHHHHHHHHHHHHTcccHHHHHcccEEEEEEETTEEEEEEEEccHHHHHHHHHHHHHTTccccccEEEE#cccccHHHHHHHHHTTccEEEEcccccHHHHHHHHHHTcEEEEEEETTEEEEEEcGGGcc# DISOP:02AL 1-2,4-7| PSIPRED cEEEEEccEEEEEEEEccEEEEEccEEEEEEEEEEEEccEEEEEEEEccccHHHHHHHHHHcccccccHHHEEEEEEEccccEEEEEEccccHHHHHHHHcccccccccccccccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEcccEEEEEEEccHHHHHHHHHHHHHHccccHHcEEEEEEccccHHHHHHHHHccccEEEEEccccHHHHHHHHHHcccEEEEEEcccEEEEcccccccc //