[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51384.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:59 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51384.1 GT:GENE ABO51384.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3127238..3127417) GB:FROM 3127238 GB:TO 3127417 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: chy:CHY_0797 hypothetical protein GB:PROTEIN_ID ABO51384.1 GB:DB_XREF GI:134053413 LENGTH 59 SQ:AASEQ MDEQKEKIIQTIKETAKDGGISCTAARKIASDYNVSPKVVGDICDELKIKLKACELGCF GT:EXON 1|1-59:0| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,8-9| PSIPRED ccHHHHHHHHHHHHHHHHccEEHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccc //