[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51398.1
DDBJ      :             transcriptional modulator of MazE/toxin, MazF
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  139/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.34.6
:116 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->115 1ne8A PDBj 9e-36 69.9 %
:RPS:PDB   3->111 2c06A PDBj 8e-23 25.9 %
:RPS:SCOP  1->115 1ne8A  b.34.6.2 * 3e-30 57.4 %
:HMM:SCOP  1->116 1ne8A_ b.34.6.2 * 2.1e-37 49.1 %
:RPS:PFM   5->111 PF02452 * PemK 1e-16 42.5 %
:HMM:PFM   4->110 PF02452 * PemK 2.5e-33 44.2 104/110  
:BLT:SWISS 1->115 ENDOA_BACSU 2e-35 69.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51398.1 GT:GENE ABO51398.1 GT:PRODUCT transcriptional modulator of MazE/toxin, MazF GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3140575..3140925) GB:FROM 3140575 GB:TO 3140925 GB:DIRECTION - GB:PRODUCT transcriptional modulator of MazE/toxin, MazF GB:NOTE PFAM: PemK family protein KEGG: chy:CHY_0716 regulatory protein, PemK family GB:PROTEIN_ID ABO51398.1 GB:DB_XREF GI:134053427 InterPro:IPR003477 LENGTH 116 SQ:AASEQ MQVRRGDVFYADLSPVVGSEQGGIRPVLILQNDIGNQYSPTTIIAAITSQIAKAKLPTHVEIQAKESGLEKDSVVLLEQLRTIDKSRLFEKVSSLNNDFMNKVNRAVEISLGLVEI GT:EXON 1|1-116:0| BL:SWS:NREP 1 BL:SWS:REP 1->115|ENDOA_BACSU|2e-35|69.6|115/116| SEG 41->54|ttiiaaitsqiaka| BL:PDB:NREP 1 BL:PDB:REP 3->115|1ne8A|9e-36|69.9|113/116| RP:PDB:NREP 1 RP:PDB:REP 3->111|2c06A|8e-23|25.9|108/110| RP:PFM:NREP 1 RP:PFM:REP 5->111|PF02452|1e-16|42.5|106/108|PemK| HM:PFM:NREP 1 HM:PFM:REP 4->110|PF02452|2.5e-33|44.2|104/110|PemK| GO:PFM:NREP 1 GO:PFM GO:0003677|"GO:DNA binding"|PF02452|IPR003477| RP:SCP:NREP 1 RP:SCP:REP 1->115|1ne8A|3e-30|57.4|115/116|b.34.6.2| HM:SCP:REP 1->116|1ne8A_|2.1e-37|49.1|116/0|b.34.6.2|1/1|Cell growth inhibitor/plasmid maintenance toxic component| OP:NHOMO 171 OP:NHOMOORG 144 OP:PATTERN ---------------------------11----------11------1-------------------- ------------------------------------------------------------------1----------------------------------------1--------------------------------1------2--1-5-------------1-13---------------------11111111111111111111111111121111111-111111111111111111111111112-1-11-1---111111111111---------------------------------1-------------111212222222121112222111-1111121222111111111112-------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 113 STR:RPRED 97.4 SQ:SECSTR ##ccTTEEEEEcccccccccccccEEEEEcccHHHHHHHccccEEcEEccccccccccTTccccTTcccccccEEccccccccccccccEEEEEccHHHHHHHTTTcGGGcTccc# DISOP:02AL 1-1| PSIPRED cEEEccEEEEEEccccccccccccEEEEEEEcccccccccEEEEEEcccccccccccEEEEEccccccccccEEEEEEEEEEEcHHHHHHEEccccHHHHHHHHHHHHHHcccEEc //