[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51403.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:111 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   36->58 2cs8A PDBj 2e-04 56.5 %
:HMM:PFM   39->58 PF01530 * zf-C2HC 0.00012 40.0 20/31  
:HMM:PFM   25->34 PF03335 * Phage_fiber 0.00098 60.0 10/14  
:BLT:SWISS 10->91 YMAF_BACSU 7e-07 35.9 %
:REPEAT 3|13->40|50->77|83->104

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51403.1 GT:GENE ABO51403.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 3142952..3143287 GB:FROM 3142952 GB:TO 3143287 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: bld:BLi01960 YmaF GB:PROTEIN_ID ABO51403.1 GB:DB_XREF GI:134053432 LENGTH 111 SQ:AASEQ MSVIIADPIPFHHHFVIGRTATINNHYHSFSGVTGPEIPLPHCANLGHVHEIYVTHCSFLYMHNHQIKGITGPPIWLSETEHYHIIYGSTYPCPADNHIHDFSGSSKIFCL GT:EXON 1|1-111:0| BL:SWS:NREP 1 BL:SWS:REP 10->91|YMAF_BACSU|7e-07|35.9|78/137| NREPEAT 1 REPEAT 3|13->40|50->77|83->104| BL:PDB:NREP 1 BL:PDB:REP 36->58|2cs8A|2e-04|56.5|23/108| HM:PFM:NREP 2 HM:PFM:REP 39->58|PF01530|0.00012|40.0|20/31|zf-C2HC| HM:PFM:REP 25->34|PF03335|0.00098|60.0|10/14|Phage_fiber| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccEEEccccccccEEEEEEEEEEcccEEEEEcccccccccccccccccEEEEEEEEEEEEEEccEEEEEEccccEEcccccEEEEEEcccccccccccEEccccccEEEEc //