[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51404.1
DDBJ      :             Rhomboid family protein
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  244/915 : Eukaryota  18/199 : Viruses  0/175   --->[See Alignment]
f.51.1
:215 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   16->138 2o7lA PDBj 8e-06 29.8 %
:RPS:SCOP  11->206 2ic8A1  f.51.1.1 * 2e-18 23.0 %
:HMM:SCOP  11->214 2ic8A1 f.51.1.1 * 5.7e-36 40.7 %
:RPS:PFM   59->206 PF01694 * Rhomboid 2e-19 44.0 %
:HMM:PFM   59->211 PF01694 * Rhomboid 3.3e-35 38.7 137/146  
:BLT:SWISS 69->206 PCP1_YEAST 9e-11 37.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51404.1 GT:GENE ABO51404.1 GT:PRODUCT Rhomboid family protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3143329..3143976) GB:FROM 3143329 GB:TO 3143976 GB:DIRECTION - GB:PRODUCT Rhomboid family protein GB:NOTE PFAM: Rhomboid family protein KEGG: aae:aq_1327 hypothetical protein GB:PROTEIN_ID ABO51404.1 GB:DB_XREF GI:134053433 InterPro:IPR002610 LENGTH 215 SQ:AASEQ MIPLKDNIPSRRFPLVTIILILLNTFAWLYEQSLGPYMDNLIFALGVTPAEIFKYGLLGQFFFMTTAMFLHGSWMHFLGNMLYLWIFGDNVEDRMGKLRFLLFYLITGYSATLAHVFSDPTSTSPLIGASGAIAGVLGGYFVLFPHARVLTLIPIFVFIQIIHIPALYFLGFWFLLQVVNQTFSIQGAQSVAFLAHIGGFAAGALLVKFFQKYRY GT:EXON 1|1-215:0| BL:SWS:NREP 1 BL:SWS:REP 69->206|PCP1_YEAST|9e-11|37.6|109/346| TM:NTM 5 TM:REGION 4->26| TM:REGION 42->64| TM:REGION 125->147| TM:REGION 154->176| TM:REGION 188->210| SEG 153->165|ipifvfiqiihip| BL:PDB:NREP 1 BL:PDB:REP 16->138|2o7lA|8e-06|29.8|114/175| RP:PFM:NREP 1 RP:PFM:REP 59->206|PF01694|2e-19|44.0|134/146|Rhomboid| HM:PFM:NREP 1 HM:PFM:REP 59->211|PF01694|3.3e-35|38.7|137/146|Rhomboid| GO:PFM:NREP 2 GO:PFM GO:0004252|"GO:serine-type endopeptidase activity"|PF01694|IPR002610| GO:PFM GO:0016021|"GO:integral to membrane"|PF01694|IPR002610| RP:SCP:NREP 1 RP:SCP:REP 11->206|2ic8A1|2e-18|23.0|174/182|f.51.1.1| HM:SCP:REP 11->214|2ic8A1|5.7e-36|40.7|182/0|f.51.1.1|1/1|Rhomboid-like| OP:NHOMO 342 OP:NHOMOORG 282 OP:PATTERN 111111----------1-22111------------1-------------111-1----------2-11 -42-3------------11-1----111111-1111-1--2111--1--11-111---11--1----3211----------111-11111-1---------1-111--1----------------1111111111112221---21223111-11-----------1333----------------1111---1---------------11--1------1-1-----------1111111111111111111----------------------------------------------------------------------1--1-----------1---11111-1--1---1--1111-11-111-1--211-11----------1-------------------------1--112--11-21211111-1---1111111111--------------11--------------------------------1-1----------------111----------------111-----1--------1------------------1211-111-11111-----11-111121111-1--1---1111--------------------21-----1--11-------1--1--1---21----------------------------------------------------------------------------------------------1---------2------------------------------------------------------------------------22121221112222----222222--------1---------------------------12-22222221-1 --------------------------1----------11111111------------------------------------------------------------------------------------------------------------------------------------1-----1--111-111-1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 122 STR:RPRED 56.7 SQ:SECSTR ###############HHHHHHHHHHHHHHHHHHHcHHHHHHHHcccccGGGTTHHT###cGGGGTGGGGccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHH##HHHHHHHHHHHHHcccccccHHHHHHHHHHHHH######################################################################### PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccHHHcccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccc //