[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51412.1
DDBJ      :             spore coat peptide assembly protein cotJB
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  59/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:94 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 17->92 COTJB_BACSU 7e-16 45.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51412.1 GT:GENE ABO51412.1 GT:PRODUCT spore coat peptide assembly protein cotJB GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 3151632..3151916 GB:FROM 3151632 GB:TO 3151916 GB:DIRECTION + GB:PRODUCT spore coat peptide assembly protein cotJB GB:NOTE KEGG: mta:Moth_1391 spore coat peptide assembly protein cotJB GB:PROTEIN_ID ABO51412.1 GB:DB_XREF GI:134053441 LENGTH 94 SQ:AASEQ MTTMDANTNAMPQHQILMQIMQLEFAGVELNLFLDTHPDCQEALTQFNQVHQQLMQCKKSYEQMYGPLCNYGFSPNVGNYWRWVETPWPWDIKY GT:EXON 1|1-94:0| BL:SWS:NREP 1 BL:SWS:REP 17->92|COTJB_BACSU|7e-16|45.3|75/100| OP:NHOMO 61 OP:NHOMOORG 59 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111111111111111--11-11111112---------11-------------------------------------------------------------------------------------------11-1111111111-12111-11--1---1-1---111-1--1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEcc //