[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51425.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:161 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51425.1 GT:GENE ABO51425.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3163293..3163778) GB:FROM 3163293 GB:TO 3163778 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: cpf:CPF_0742 hypothetical protein GB:PROTEIN_ID ABO51425.1 GB:DB_XREF GI:134053454 LENGTH 161 SQ:AASEQ MEYHRGVFKNLSKNYIVSFYCNKLPLVTYYGIKARRFHMNKYEKEYFDNIMDGVKDSCTKGMTPSVQTHVHEFLGSTQLAVQGELRHNHRFAGVTSEEIPKGDSHVHAILVNTDFFFNHFHELGVETGPAIPVGNDDLMKQNRKSYLIDTVIVDKTKHRAV GT:EXON 1|1-161:0| OP:NHOMO 35 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2444423412--1----1-2------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,159-162| PSIPRED ccHHHHHHHcccccEEEEEEEccccEEEEEEcEEEEEEccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccEEEEEEEEccccEEccccHHHccccccEEEEEEEEHHHHHHHHHHcccccccccccccHHHHHHccHHHEEEEEEEEccccccc //