[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51447.1
DDBJ      :             Cl- channel, voltage-gated family protein
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  393/915 : Eukaryota  78/199 : Viruses  0/175   --->[See Alignment]
d.286.1f.20.1
:526 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   67->438 1kplB PDBj 2e-33 31.8 %
:BLT:PDB   460->518 3jxoB PDBj 3e-08 37.3 %
:RPS:PDB   86->165 3ejzA PDBj 1e-33 38.8 %
:RPS:PDB   289->372 3ejzA PDBj 2e-07 20.0 %
:RPS:PDB   390->518 2bknA PDBj 3e-10 14.0 %
:RPS:SCOP  21->440 1kpkA  f.20.1.1 * 1e-70 25.3 %
:RPS:SCOP  445->518 1vctA2  d.286.1.1 * 1e-08 17.6 %
:HMM:SCOP  19->441 1kplA_ f.20.1.1 * 8.7e-108 37.6 %
:HMM:SCOP  431->520 2fy8A2 d.286.1.1 * 1.8e-10 27.0 %
:RPS:PFM   78->418 PF00654 * Voltage_CLC 6e-35 36.1 %
:RPS:PFM   451->518 PF02080 * TrkA_C 8e-04 32.4 %
:HMM:PFM   17->80 PF00654 * Voltage_CLC 8.9e-05 25.8 62/355  
:HMM:PFM   77->418 PF00654 * Voltage_CLC 6.3e-102 41.2 342/355  
:HMM:PFM   459->518 PF02080 * TrkA_C 7.1e-14 40.0 60/71  
:BLT:SWISS 23->436 CLCA_VIBPA 5e-44 37.7 %
:BLT:SWISS 465->517 TRKA_METJA 6e-05 32.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51447.1 GT:GENE ABO51447.1 GT:PRODUCT Cl- channel, voltage-gated family protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 3188171..3189751 GB:FROM 3188171 GB:TO 3189751 GB:DIRECTION + GB:PRODUCT Cl- channel, voltage-gated family protein GB:NOTE PFAM: Cl- channel, voltage-gated family protein; TrkA-C domain protein KEGG: cno:NT01CX_0195 voltage gated chloride channel family protein GB:PROTEIN_ID ABO51447.1 GB:DB_XREF GI:134053476 InterPro:IPR001807 InterPro:IPR006037 LENGTH 526 SQ:AASEQ MVKKKEHGLLSPLFQWRDFRLKLFVEAILIGFLSGALVVFFRFMLEKSEEVRDHIYLLLGQQGLPYYVLWFLILVAIGLLLGYIVKLVPMSTGSGIPQVKGILTGQLKMNWLRVILAKFIGGVLAIGAGLSLGREGPSVQLGAAIGQGISRMLGRLRIEEKYLITSGASAGLAAAFNAPLAGVIFALEELHKNFSPAVLMSAMAASLTADFVSQQFFGPRPIFSFQALPVLPTYYFVHLIGLGIVCGVLGFFFNWSLIKALNFYSKLTIMPKIFVPVLPLILGGFLGFYLPEALGGGHKLIDSLAQGNLGLKMLVIFFIAKFFFTMASFGSGVPGGIFLPLLVIGALVGNIYGDIVITLLHIDPYFRDNFIVFAMAAYFSAIVKAPVTGSILITEMTGSFHHLLALITVSMVSYVVCDILNSKPVYELLLDRILANKDPRLSKNEGKNKVIIELATCIGSTLDGKRIKDILWPPHCLLVSIKRGEQEIIPKGDTKILGGDYLFIVVSEDQAPDVNQLLTKLAGEGS GT:EXON 1|1-526:0| BL:SWS:NREP 2 BL:SWS:REP 23->436|CLCA_VIBPA|5e-44|37.7|403/467| BL:SWS:REP 465->517|TRKA_METJA|6e-05|32.1|53/218| TM:NTM 10 TM:REGION 22->44| TM:REGION 65->87| TM:REGION 108->130| TM:REGION 166->188| TM:REGION 229->251| TM:REGION 268->290| TM:REGION 308->330| TM:REGION 337->359| TM:REGION 371->393| TM:REGION 400->422| SEG 57->64|lllgqqgl| SEG 166->182|sgasaglaaafnaplag| SEG 239->253|liglgivcgvlgfff| BL:PDB:NREP 2 BL:PDB:REP 67->438|1kplB|2e-33|31.8|371/451| BL:PDB:REP 460->518|3jxoB|3e-08|37.3|59/85| RP:PDB:NREP 3 RP:PDB:REP 86->165|3ejzA|1e-33|38.8|80/444| RP:PDB:REP 289->372|3ejzA|2e-07|20.0|73/444| RP:PDB:REP 390->518|2bknA|3e-10|14.0|129/190| RP:PFM:NREP 2 RP:PFM:REP 78->418|PF00654|6e-35|36.1|338/351|Voltage_CLC| RP:PFM:REP 451->518|PF02080|8e-04|32.4|68/71|TrkA_C| HM:PFM:NREP 3 HM:PFM:REP 17->80|PF00654|8.9e-05|25.8|62/355|Voltage_CLC| HM:PFM:REP 77->418|PF00654|6.3e-102|41.2|342/355|Voltage_CLC| HM:PFM:REP 459->518|PF02080|7.1e-14|40.0|60/71|TrkA_C| GO:PFM:NREP 6 GO:PFM GO:0005247|"GO:voltage-gated chloride channel activity"|PF00654|IPR001807| GO:PFM GO:0006821|"GO:chloride transport"|PF00654|IPR001807| GO:PFM GO:0016020|"GO:membrane"|PF00654|IPR001807| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00654|IPR001807| GO:PFM GO:0006813|"GO:potassium ion transport"|PF02080|IPR006037| GO:PFM GO:0008324|"GO:cation transmembrane transporter activity"|PF02080|IPR006037| RP:SCP:NREP 2 RP:SCP:REP 21->440|1kpkA|1e-70|25.3|419/450|f.20.1.1| RP:SCP:REP 445->518|1vctA2|1e-08|17.6|74/94|d.286.1.1| HM:SCP:REP 19->441|1kplA_|8.7e-108|37.6|423/430|f.20.1.1|1/1|Clc chloride channel| HM:SCP:REP 431->520|2fy8A2|1.8e-10|27.0|89/0|d.286.1.1|1/1|TrkA C-terminal domain-like| OP:NHOMO 616 OP:NHOMOORG 486 OP:PATTERN ----11-1---------------1--------1---1-----------11----1-111111------ 111-1-------1--------1----------1111-1--1---------------------------1--1---1111-----1---2222-2-1----1111-11--1---------------111111111111---------122111---11111-1-1211113-111-111---11-----1----------------------------------------------------------------1211121121311222111121-11111111111--1111111111111111111111111111121111-1--1-------1---1111222-1-11--------1--1--1---1111-------------1-11---1----11111111112-11-1111-1-1-111211-132--11---111----1----------12111----------------------------------1-------1111111-11111121111112212-----1221--1----------------1---------------1112121-11111----11-1-------------------------------2-1--11-11-1-2-1----------------------11--------211-11-2222222222-2222222222222222222222-1--1211111111111111122222222--211111111111---------1111-1---111--1--------------------1-------1---------111111111-111111111111111111111111----1-11111122--------1-1-------------------------1-----1----21 ----1-1-11-----1222-1111-11-1-11111-11-11-11--1111------------1-1--1-3--1-1---------11-1--212----1-11-211--1-16-----2------------------1--------1----------11--2121125-8363-321----------3---21-112-11- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 452 STR:RPRED 85.9 SQ:SECSTR ##################################################################GGTHHHHHHHHHHHHHHHHHHcGGGccccHHHHHHHHHTcccccHHHHHHHHHHHHHHHTTTTcccccHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHHHTcHHHHHHHHTTTTccccHTTTccHHHHHHHHHHHHHHHHHcccccccccccccccTTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcGGGccccHHHHHHTcccccHHHHHHHHHHHHHHHHHHHTTTTcccccHHHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHTHHHHHHTccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccTHHHHHHHccccEEEEEEccTTcTTTTccHHHHcHHHHcEEEEEEETTEEEEccccccccTTcEEEEEEcHHHHHHHHHHH######## DISOP:02AL 1-2,436-448,523-527| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccccccccEEEEEEccccccccEEEEEcccccccEEEEEEEccEEEEEcccEEEccccEEEEEEcHHHHHHHHHHHHHcccccc //