[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51465.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:224 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   79->107 PF06658 * DUF1168 0.00053 41.4 29/142  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51465.1 GT:GENE ABO51465.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 3215851..3216525 GB:FROM 3215851 GB:TO 3216525 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO51465.1 GB:DB_XREF GI:134053494 LENGTH 224 SQ:AASEQ MAKAKTQETILTVSGYEVDKDLIRVPIKVSPSLQALIANQLELMEIVEKNHSDYHIFIEQHRMELLQIEQEISYAYTNYMKKKEKAREKREQKKATLAVEPPKSEEEFPFIEGSVSADTHPASPEELPWDDSPGHSFQEKNDYDIGYRDEKPVPSLDEMADRMSPGLPSAKYEPRTAPVETKPDIDVRRVAIGAAIKSLRSFLGRELTEEEIVQIENQVDSYLK GT:EXON 1|1-224:0| SEG 81->95|kkkekarekreqkka| HM:PFM:NREP 1 HM:PFM:REP 79->107|PF06658|0.00053|41.4|29/142|DUF1168| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,80-101,221-221,224-225| PSIPRED cccccccEEEEEEEcccccccEEEccEEEcHHHHHHHHHHHHHHHHHHcccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHc //