[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51469.1
DDBJ      :             glycyl-radical enzyme activating protein family
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  328/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.1.28d.218.1d.58.1
:297 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->43,115->293 3cb8A PDBj 6e-25 32.4 %
:BLT:PDB   53->91 1fcaA PDBj 9e-06 48.7 %
:RPS:PDB   52->94 1durA PDBj 8e-09 44.2 %
:RPS:PDB   122->297 3canA PDBj 3e-17 36.3 %
:RPS:SCOP  53->94 1durA  d.58.1.1 * 1e-10 45.2 %
:RPS:SCOP  173->268 2o5aA1  d.218.1.12 * 1e-15 12.5 %
:HMM:SCOP  29->123 2fug91 d.58.1.5 * 6.7e-18 32.6 %
:HMM:SCOP  79->269 1tv8A_ c.1.28.3 * 7.5e-15 24.5 %
:HMM:PFM   23->231 PF04055 * Radical_SAM 7.2e-29 34.0 153/166  
:BLT:SWISS 6->297 PFLE_ECOLI 1e-38 34.2 %
:PROS 80->91|PS00198|4FE4S_FER_1
:PROS 17->38|PS01087|RADICAL_ACTIVATING
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51469.1 GT:GENE ABO51469.1 GT:PRODUCT glycyl-radical enzyme activating protein family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3221324..3222217) GB:FROM 3221324 GB:TO 3222217 GB:DIRECTION - GB:PRODUCT glycyl-radical enzyme activating protein family GB:NOTE TIGRFAM: glycyl-radical enzyme activating protein family PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain protein; Radical SAM domain protein KEGG: gsu:GSU2102 pyruvate formate-lyase-activating enzyme, putative GB:PROTEIN_ID ABO51469.1 GB:DB_XREF GI:134053498 InterPro:IPR001450 InterPro:IPR001989 InterPro:IPR007197 InterPro:IPR012839 LENGTH 297 SQ:AASEQ MLTGSIFDIMKYSIRDGPGIRTTIFFKGCPLKCLWCHNPESQDPEPQLMFWPDRCIGCGDCVETCVNQAILPGGIHKERCRRCGQCAAVCPTLAREMVGRRVAVEEVVREIERDRIFYEESGGGVTFSGGEPLVQPSFLHSLLDACQDREIATAVDTTGYTAEETLLSISEKVDLFLYDIKLMDDEKHKLFTGVSNRLILNNLQKLSQRHPHIIIRIPIIPGINDDRENLEQMASFISTLQNIWEVQLLPYHNTGMGKYERLNLPYQLAQTQPPADEAMQLLAGEFRSYGLNVKIGG GT:EXON 1|1-297:0| BL:SWS:NREP 1 BL:SWS:REP 6->297|PFLE_ECOLI|1e-38|34.2|292/308| PROS 80->91|PS00198|4FE4S_FER_1|PDOC00176| PROS 17->38|PS01087|RADICAL_ACTIVATING|PDOC00834| SEG 95->113|remvgrrvaveevvreier| SEG 209->221|rhphiiiripiip| BL:PDB:NREP 2 BL:PDB:REP 16->43,115->293|3cb8A|6e-25|32.4|207/244| BL:PDB:REP 53->91|1fcaA|9e-06|48.7|39/55| RP:PDB:NREP 2 RP:PDB:REP 52->94|1durA|8e-09|44.2|43/55| RP:PDB:REP 122->297|3canA|3e-17|36.3|157/158| HM:PFM:NREP 1 HM:PFM:REP 23->231|PF04055|7.2e-29|34.0|153/166|Radical_SAM| RP:SCP:NREP 2 RP:SCP:REP 53->94|1durA|1e-10|45.2|42/55|d.58.1.1| RP:SCP:REP 173->268|2o5aA1|1e-15|12.5|88/108|d.218.1.12| HM:SCP:REP 29->123|2fug91|6.7e-18|32.6|95/0|d.58.1.5|1/1|4Fe-4S ferredoxins| HM:SCP:REP 79->269|1tv8A_|7.5e-15|24.5|184/0|c.1.28.3|2/2|Radical SAM enzymes| OP:NHOMO 674 OP:NHOMOORG 337 OP:PATTERN -----------------------1----------1-----------------------1-1---1--- -----11-----------------------------------------1---------------1------11111112--1------2232-3----------------------------------------------------1-1----11----------1--------------------------1-111111111111111--11--1111----11111111-1111111111111111111--1---11-----22--1111----11122222222222222222222222222222222222221112222-5214444445454414334222322-1111--33-411111-----112-----------------1---3--1------------------------------------------------------------------2----------------------------------1--------------------------------------------------------1-----------1-1-6212-3321322--13--11-2------------------------------------413-------11222211211121222222--1----------42112314445455544-4444445454454444445243121134243434433434334244444441-211111111111------------------111111111-11111---------------------------------------22121111113222----------------------------------1-------------------------------1-----1 ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1-1---------2----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 276 STR:RPRED 92.9 SQ:SECSTR #ccEEEEEEEEEEcccccccEEEEEEcccccccTTcccGGGccccccEEEcHHHHHHHGHHHGGGHHHHHEEEEEEccGGGGHHHHHHHHHHHc####################HHTcEEEcccEEEcccTGGGcHHHHHHHHHHHHHTTccEEEEcTTcccHHHHHHHHHTccEEEEEcccccHHHHHHHHccccHHHHHHHHHHHHTTccEEEEEEEccTTTccHHHHHHHHHHHHHcccccEEEEEEccccccccHHHHTcccTTTTcccccHHHHHHHHHHHHHTTccEEEcc DISOP:02AL 1-1| PSIPRED ccccEEccEEEccccccccEEEEEEEEccccccccccccccccccEEEEEccccccccccHHHHccccccccccccHHHccccccccccccccccEEEcccccHHHHHHHHHHHHccccccccEEEEEcccccccHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHccEEEEEEccccHHHHHHHHcccHHHHHHHHHHHHHccccEEEEEEEEccccccHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHccccccccccccccHHHHHHHHHHHHHcccEEEEcc //