Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51478.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:HMM:PFM   21->75 PF05445 * Pox_ser-thr_kin 4e-05 23.6 55/434  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51478.1 GT:GENE ABO51478.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3231958..3232233) GB:FROM 3231958 GB:TO 3232233 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO51478.1 GB:DB_XREF GI:134053507 LENGTH 91 SQ:AASEQ MTNTNPGNGDSQVPIHRPIEFLINQKISDATVEVTDLNEKNNVTGTVEIKENKVLFHLFTAFYPIIVIKWFYVQNQKRVRALRNMKYIFPQ GT:EXON 1|1-91:0| TM:NTM 1 TM:REGION 52->74| HM:PFM:NREP 1 HM:PFM:REP 21->75|PF05445|4e-05|23.6|55/434|Pox_ser-thr_kin| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9| PSIPRED ccccccccccccccHHHHHHHHHcccccccEEEEEEccccccEEEEEEEEccEEHHHHHHHHHHHHHHEEEEEccHHHHHHHHccHHHccc //