[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51482.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.3.1
:164 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  23->150 2ebfX3  d.3.1.17 * 1e-08 10.0 %
:RPS:PFM   24->107 PF01609 * Transposase_11 2e-09 38.0 %
:HMM:PFM   13->108 PF01609 * Transposase_11 4.6e-15 24.4 90/207  
:BLT:SWISS 4->84 T1106_NEIMB 3e-04 42.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51482.1 GT:GENE ABO51482.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3235291..3235785) GB:FROM 3235291 GB:TO 3235785 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: swo:Swol_0138 hypothetical protein GB:PROTEIN_ID ABO51482.1 GB:DB_XREF GI:134053511 LENGTH 164 SQ:AASEQ MQGDKTANWGAKRDTHGNQISWFGYKAHVAVDCHSELPIAIMVTPANTHDAKMAIPLIELVNKALEDSKKPKYYTMDMGYDSKDIYSVVMNDFNAQAIIPINSRGSKDHPEGCDFDGTPICSMGQRMVFWGSDAKAGTNKYRCPHVMGKCDCPYGSAWCSPSSY GT:EXON 1|1-164:0| BL:SWS:NREP 1 BL:SWS:REP 4->84|T1106_NEIMB|3e-04|42.4|66/288| RP:PFM:NREP 1 RP:PFM:REP 24->107|PF01609|2e-09|38.0|79/192|Transposase_11| HM:PFM:NREP 1 HM:PFM:REP 13->108|PF01609|4.6e-15|24.4|90/207|Transposase_11| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF01609|IPR002559| GO:PFM GO:0004803|"GO:transposase activity"|PF01609|IPR002559| GO:PFM GO:0006313|"GO:transposition, DNA-mediated"|PF01609|IPR002559| RP:SCP:NREP 1 RP:SCP:REP 23->150|2ebfX3|1e-08|10.0|110/192|d.3.1.17| OP:NHOMO 35 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------4------------------5--------------------------------------------------------------------------------------------------------------------------------------------------9-3-D-----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,104-110,162-165| PSIPRED ccccccccccccccccccccEEEEEEEEEEEEccccEEEEEEEcccccccHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHccccEEEccccccccccccccccccccccccccEEEEEEccccccccccccHHHHccccccccccccccccc //