[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51487.1
DDBJ      :             SsrA-binding protein
Swiss-Prot:SSRP_DESRM   RecName: Full=SsrA-binding protein;

Homologs  Archaea  0/68 : Bacteria  902/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
b.111.1
:161 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->133 1j1hA PDBj 5e-34 54.2 %
:RPS:PDB   13->133 2czjA PDBj 2e-51 61.2 %
:RPS:SCOP  10->134 1p6vA  b.111.1.1 * 2e-47 57.0 %
:HMM:SCOP  6->138 1k8hA_ b.111.1.1 * 1.8e-52 61.4 %
:RPS:PFM   13->77 PF01668 * SmpB 8e-22 67.7 %
:HMM:PFM   12->79 PF01668 * SmpB 5.3e-35 58.8 68/68  
:BLT:SWISS 1->161 SSRP_DESRM 3e-79 100.0 %
:PROS 32->44|PS01317|SSRP
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51487.1 GT:GENE ABO51487.1 GT:PRODUCT SsrA-binding protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3242267..3242752) GB:FROM 3242267 GB:TO 3242752 GB:DIRECTION - GB:PRODUCT SsrA-binding protein GB:NOTE TIGRFAM: SsrA-binding protein PFAM: SmpB protein KEGG: mta:Moth_0275 SsrA-binding protein GB:PROTEIN_ID ABO51487.1 GB:DB_XREF GI:134053516 InterPro:IPR000037 LENGTH 161 SQ:AASEQ MAAKATSEKGFKTITDNRRARHEYHVIETYEAGIALSGTEVKSLRAGKANLQDAFARVENGEMMLYNLHISPYEQGNRFNHEPKRTRRLLMHKQEILRLYGKVREKGLALIPLKVYFNPRGKVKVQLALAQGKKSYDKRHDIAARDAKRDMDRAMRERQKM GT:EXON 1|1-161:0| SW:ID SSRP_DESRM SW:DE RecName: Full=SsrA-binding protein; SW:GN Name=smpB; OrderedLocusNames=Dred_2984; SW:KW Complete proteome; Cytoplasm; RNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->161|SSRP_DESRM|3e-79|100.0|161/161| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| PROS 32->44|PS01317|SSRP|PDOC01021| SEG 141->156|diaardakrdmdramr| BL:PDB:NREP 1 BL:PDB:REP 14->133|1j1hA|5e-34|54.2|120/123| RP:PDB:NREP 1 RP:PDB:REP 13->133|2czjA|2e-51|61.2|121/122| RP:PFM:NREP 1 RP:PFM:REP 13->77|PF01668|8e-22|67.7|65/69|SmpB| HM:PFM:NREP 1 HM:PFM:REP 12->79|PF01668|5.3e-35|58.8|68/68|SmpB| GO:PFM:NREP 2 GO:PFM GO:0003723|"GO:RNA binding"|PF01668|IPR000037| GO:PFM GO:0006412|"GO:translation"|PF01668|IPR000037| RP:SCP:NREP 1 RP:SCP:REP 10->134|1p6vA|2e-47|57.0|121/125|b.111.1.1| HM:SCP:REP 6->138|1k8hA_|1.8e-52|61.4|132/133|b.111.1.1|1/1|Small protein B (SmpB)| OP:NHOMO 916 OP:NHOMOORG 910 OP:PATTERN -------------------------------------------------------------------- 111111111111111-111-111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111221111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111-111111-11--1-1111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111-11111 ------------------------------------------------------------------------------------------------------------2-----------------------------------------------------------------11----------------2111--1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 78.3 SQ:SECSTR ############ccEEcHHHHTTcccccEEEEEcccccHHHHHHHccccccTTcEEEEccccEEEEcccccTTcccccccccccccEEccccHHHHHHHHHTTTTTTcccEEEEEEEcTTccEEEEEEcccccccccc####################### DISOP:02AL 1-13,158-162| PSIPRED cccccccccccEEEEEcccEEccEEEEEEEEccEEEEHHHHHHHHHccccEEEEEEEEEccEEEEEEcccccccccccccccccccHHHHHcHHHHHHHHHHHHHcccEEEEEEEEEccccEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHcccc //