[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51496.1
DDBJ      :             beta-lactamase domain protein
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:328 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   46->107 1zkpC PDBj 6e-05 38.6 %
:RPS:PDB   59->216 2dkfA PDBj 1e-11 19.2 %
:RPS:SCOP  40->287 1y44A1  d.157.1.7 * 4e-20 19.4 %
:HMM:SCOP  38->322 2cbnA1 d.157.1.7 * 2.1e-36 21.1 %
:RPS:PFM   87->116 PF00753 * Lactamase_B 5e-04 46.7 %
:HMM:PFM   73->210 PF00753 * Lactamase_B 1.1e-11 19.4 129/194  
:BLT:SWISS 40->314 Y1374_METJA 1e-21 34.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51496.1 GT:GENE ABO51496.1 GT:PRODUCT beta-lactamase domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3253345..3254331) GB:FROM 3253345 GB:TO 3254331 GB:DIRECTION - GB:PRODUCT beta-lactamase domain protein GB:NOTE PFAM: beta-lactamase domain protein KEGG: chy:CHY_0276 hypothetical protein GB:PROTEIN_ID ABO51496.1 GB:DB_XREF GI:134053525 InterPro:IPR001279 LENGTH 328 SQ:AASEQ MDIKKIDQELREKTGTAAIESYTKYRHRQEPAPAAPGASVLFLGTGGNPEAVFSQVPRTAGFILVVDGLRLYVDPGPGAVVRAREAGLDLGSLDGIFISHGHLDHYAGAEAVIEAMCWGMFVRRGVVLAPRQVLERDRLLSIYHQGKDRLSGYKGGPTVRILEAHQPMPIGKVALTPIPAYHGEENYGFILQTESLTLGYTSDTNYIQGYTTPEGSKDLSYRGPIMDLIDIVDYRTDIKEAFSQVDVLIANVTSHNVYAHRHITTLGLAHLLRGSKVKLCIMTHFNHCCLSPDDLRPPMATYVEQTSGVRTLYAVDGGNYNIAEILRR GT:EXON 1|1-328:0| BL:SWS:NREP 1 BL:SWS:REP 40->314|Y1374_METJA|1e-21|34.9|235/266| BL:PDB:NREP 1 BL:PDB:REP 46->107|1zkpC|6e-05|38.6|57/240| RP:PDB:NREP 1 RP:PDB:REP 59->216|2dkfA|1e-11|19.2|156/424| RP:PFM:NREP 1 RP:PFM:REP 87->116|PF00753|5e-04|46.7|30/171|Lactamase_B| HM:PFM:NREP 1 HM:PFM:REP 73->210|PF00753|1.1e-11|19.4|129/194|Lactamase_B| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00753|IPR001279| RP:SCP:NREP 1 RP:SCP:REP 40->287|1y44A1|4e-20|19.4|227/269|d.157.1.7| HM:SCP:REP 38->322|2cbnA1|2.1e-36|21.1|246/0|d.157.1.7|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 33 OP:NHOMOORG 32 OP:PATTERN --------------------------------11111111111----------11111111----1-- -----------------------------------------------------------------------------------1-1-1-----------------------------------------------------111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 326 STR:RPRED 99.4 SQ:SECSTR ##GGGccHHHHHHHHccTTTTHHHHHHccEEEcccccEEEEEEEEEETcccccccccEccEEEEEETTEEEEEEEcccTTTTTccccccGGGccEEEccccccTTTTTHHHHHHTTccccEEEEEcHHHHHHHHHHHHHHHHccccccHHHHHHHHTTEEEccccccEEccccEEEEEEccccTTcEEEEEEETTEEEEEccccccTTccccccccHHHEEEEEEEEEEEccccccccHHHHTTccEEEEEccGGGcccTTcccHHHHHHHHHHTTccEEEEEccccGHHHHHHccHHHHHHHHHHHTccEEEEEcccTTccHHHHHH DISOP:02AL 1-1,15-33| PSIPRED ccHHHHHHHHHccccHHHccccccccccccccccccccEEEEEEcccccccccccccccEEEEEEEccEEEEEEccccHHHHHHHccccHHHccEEEEEcccHHHHccHHHHHHHcccccccccEEEEEcHHHHHHHHHHHHccccccccccccccccEEEEccccEEEEccEEEEEEEEccccccEEEEEEEcccEEEEEccccccccccccccccccccccccccccccccccccHHHHHccccEEEEEcccccccccccccHHHHHHHHHHccccEEEEEccccHHccHHHccHHHHHHHHHcccccEEEEccccHHHHHHHHHc //