[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51510.1
DDBJ      :             death-on-curing family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  96/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.265.1
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->117 3dd7A PDBj 1e-04 26.8 %
:RPS:PDB   1->123 3dd7A PDBj 2e-15 22.3 %
:HMM:SCOP  3->95 2g03A1 a.265.1.1 * 5.2e-06 23.8 %
:HMM:PFM   3->85 PF02661 * Fic 1.4e-15 30.9 81/96  
:BLT:SWISS 1->117 DOC_BPP1 2e-04 26.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51510.1 GT:GENE ABO51510.1 GT:PRODUCT death-on-curing family protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 3268735..3269124 GB:FROM 3268735 GB:TO 3269124 GB:DIRECTION + GB:PRODUCT death-on-curing family protein GB:NOTE TIGRFAM: death-on-curing family protein PFAM: Death-on-curing protein KEGG: dsy:DSY0631 hypothetical protein GB:PROTEIN_ID ABO51510.1 GB:DB_XREF GI:134053539 InterPro:IPR006440 LENGTH 129 SQ:AASEQ MKWLPIDYILKLHEKMILKTGGSPGVRDINLLLSAVFNAHASFGGQDLYPNIESKVAAVCHGIINNHPFVDGNKRMGIYLMLILLEYNDYHISYYEDELVDLGLAIAESILSKEYIARWIKEHNTTKMG GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 1->117|DOC_BPP1|2e-04|26.8|112/100| BL:PDB:NREP 1 BL:PDB:REP 1->117|3dd7A|1e-04|26.8|112/123| RP:PDB:NREP 1 RP:PDB:REP 1->123|3dd7A|2e-15|22.3|121/123| HM:PFM:NREP 1 HM:PFM:REP 3->85|PF02661|1.4e-15|30.9|81/96|Fic| HM:SCP:REP 3->95|2g03A1|5.2e-06|23.8|84/0|a.265.1.1|1/1|Fic-like| OP:NHOMO 103 OP:NHOMOORG 96 OP:PATTERN -------------------------------------------------------------------- --1-1----------11---------------------1---11---1--1-11-----------------1--------1---------------------------1---------------211-111--1-1---21---1--11--12---------------11---------------------------------------1----------------------------------------1--------------------1----------------------------------------------------1--------12-1----------1---1----1--1-11------1--1---------------------11--11111111111-11--111-----1-------1------1-----1-----11111111-12--------------------------------------------------------------------------------------1------------------21--------------1-------------111----------------------------1-11------------------------1--------------------------------------------------------------------------------------------------------------1---------------------------------------------------------2--------------------1-1---1---------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 96.1 SQ:SECSTR cccccHHHHHHHHHHHHHHHccccccccTTHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHTTcccccccTTHHHHHHHHHTTcccHHHHHHHHHHHT##### DISOP:02AL 126-130| PSIPRED cccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHHHHcccccHHHHHHHHHHHcccccc //