[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51515.1
DDBJ      :             HEPN domain protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.24.16
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->47 1o3uA PDBj 8e-07 55.6 %
:RPS:SCOP  8->118 1o3uA  a.24.16.3 * 2e-14 24.8 %
:HMM:SCOP  6->124 1o3uA_ a.24.16.3 * 2.7e-21 35.0 %
:RPS:PFM   8->115 PF05168 * HEPN 9e-16 43.9 %
:HMM:PFM   7->116 PF05168 * HEPN 2.6e-33 39.4 109/117  
:BLT:SWISS 5->46 Y1304_METJA 6e-04 42.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51515.1 GT:GENE ABO51515.1 GT:PRODUCT HEPN domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3272663..3273052) GB:FROM 3272663 GB:TO 3273052 GB:DIRECTION - GB:PRODUCT HEPN domain protein GB:NOTE PFAM: HEPN domain protein KEGG: dsy:DSY2699 hypothetical protein GB:PROTEIN_ID ABO51515.1 GB:DB_XREF GI:134053544 InterPro:IPR007842 LENGTH 129 SQ:AASEQ MRAQSSVWIGIAEDDLEAAEHCMHGKQYLWSMFMCQQAVEKAIKAVFFNKTGLTPPKKHDLISLAGGADILAQCSKDTRDLLRRLSLYYIEARYPDKRAELEAKCTYENTKEILQRTKGGVAWLRSMLK GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 5->46|Y1304_METJA|6e-04|42.9|42/100| BL:PDB:NREP 1 BL:PDB:REP 12->47|1o3uA|8e-07|55.6|36/119| RP:PFM:NREP 1 RP:PFM:REP 8->115|PF05168|9e-16|43.9|107/117|HEPN| HM:PFM:NREP 1 HM:PFM:REP 7->116|PF05168|2.6e-33|39.4|109/117|HEPN| RP:SCP:NREP 1 RP:SCP:REP 8->118|1o3uA|2e-14|24.8|109/120|a.24.16.3| HM:SCP:REP 6->124|1o3uA_|2.7e-21|35.0|117/126|a.24.16.3|1/1|Nucleotidyltransferase substrate binding subunit/domain| OP:NHOMO 16 OP:NHOMOORG 12 OP:PATTERN ----------------1------------------------------1--------1----------- -----------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1122--1-----12----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 62.0 SQ:SECSTR #######HHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHTTc#ccccccHHHHcccHHHH#HHH#######HHHHTccccccTTc################################# DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHc //