[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51527.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:210 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->117 3eifA PDBj 8e-04 29.3 %
:HMM:PFM   125->188 PF08045 * CDC14 0.00013 18.8 64/258  
:BLT:SWISS 35->148 P115_MYCHR 5e-05 22.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51527.1 GT:GENE ABO51527.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3282953..3283585) GB:FROM 3282953 GB:TO 3283585 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO51527.1 GB:DB_XREF GI:134053556 LENGTH 210 SQ:AASEQ MTIFFALFERTFFMDKVMDYIQALTNLYGVVHKDKVQEIYNQQNDDKIDDKSMEYIIKEKKDYLINHRQITVHKDYFVYLSIMVAGSYFDEELRAKEGKPYYIPEKEELLKYKDVNYFEVNKEYEELLQFLKKMFWRKSKAEDVAREIQMHCESFRAMENLHLLFEEKKIRFKNAKQADELMRLIRNLANNTRIWQNNGYTPNELDVGKR GT:EXON 1|1-210:0| BL:SWS:NREP 1 BL:SWS:REP 35->148|P115_MYCHR|5e-05|22.1|104/979| BL:PDB:NREP 1 BL:PDB:REP 34->117|3eifA|8e-04|29.3|82/936| HM:PFM:NREP 1 HM:PFM:REP 125->188|PF08045|0.00013|18.8|64/258|CDC14| OP:NHOMO 6 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------1------------1---3----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 82 STR:RPRED 39.0 SQ:SECSTR #################################cccEEEEEEEEEEEEETT##EEEEEEEEEEEcccEEEEEcTTEEEEEEEEEEcGGGHHHHHHHcTTcEEETTccccEEEEEEEE############################################################################################# DISOP:02AL 204-211| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHHcHHHHHHcccccccccHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHccccHHHcccccc //