[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51532.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.47.1
:219 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  31->171 1qy6A  b.47.1.1 * 7e-07 19.4 %
:HMM:SCOP  23->194 1q31A_ b.47.1.3 * 2.4e-16 29.3 %
:HMM:PFM   25->181 PF00089 * Trypsin 1.2e-06 15.6 154/219  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51532.1 GT:GENE ABO51532.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3288107..3288766) GB:FROM 3288107 GB:TO 3288766 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: xcb:XC_0344 hypothetical protein GB:PROTEIN_ID ABO51532.1 GB:DB_XREF GI:134053561 LENGTH 219 SQ:AASEQ MSVSLNQILNQFILAVGKVTTTGLSLLGTSFAVSKGKFVTTKHITGVDDNNLVLILPKTSTTNDYQDTSDTSVSYFGVKIAEIDPFKDISILTVDSNVAPPYNLSGTDTVFTGSPVVTYGFPHADHGRLVFTEQYSRIGARVLIESGGIKSKHIVLNTQARPGQSGSPIFNPTNMSVVAMLIGSYAPGGGGGISLGGVDPHTLHQTTHAISVEYIKEML GT:EXON 1|1-219:0| SEG 20->30|tttglsllgts| SEG 181->197|ligsyapgggggislgg| HM:PFM:NREP 1 HM:PFM:REP 25->181|PF00089|1.2e-06|15.6|154/219|Trypsin| RP:SCP:NREP 1 RP:SCP:REP 31->171|1qy6A|7e-07|19.4|129/216|b.47.1.1| HM:SCP:REP 23->194|1q31A_|2.4e-16|29.3|150/0|b.47.1.3|1/1|Trypsin-like serine proteases| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccccHHHHHHHHHHHcccccccEEEEEEEEEEEEccEEEEEEEEEccccccEEEEEcccccccccccccccEEEEEcEEEEEEcccccEEEEEEEccccccEEcccccccccccEEEEEEcccccccEEEEEEEEEEEEEEEccccccccccEEEEEHHccccccccccccccccEEEEEEEEEEEccccccEEEEEEEccccccEEEEEEHHHHHHcc //