[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51536.1
DDBJ      :             polysaccharide biosynthesis protein CapD
Swiss-Prot:             

Homologs  Archaea  37/68 : Bacteria  525/915 : Eukaryota  14/199 : Viruses  1/175   --->[See Alignment]
c.2.1
:340 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->311 2gn4B PDBj 3e-57 39.9 %
:RPS:PDB   1->132 1ds6B PDBj 1e-16 11.9 %
:RPS:PDB   162->323 3d5bZ PDBj 2e-22 10.1 %
:RPS:SCOP  5->243 1xq6A  c.2.1.2 * 1e-31 21.7 %
:HMM:SCOP  1->322 2c5aA1 c.2.1.2 * 7.7e-52 29.2 %
:RPS:PFM   7->282 PF02719 * Polysacc_synt_2 2e-54 44.5 %
:RPS:PFM   284->330 PF08485 * Polysacc_syn_2C 1e-14 63.8 %
:HMM:PFM   7->281 PF02719 * Polysacc_synt_2 1.5e-108 47.6 275/296  
:HMM:PFM   284->330 PF08485 * Polysacc_syn_2C 4.3e-25 63.8 47/48  
:BLT:SWISS 1->336 CAPD_RICRS e-118 61.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51536.1 GT:GENE ABO51536.1 GT:PRODUCT polysaccharide biosynthesis protein CapD GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3292559..3293581) GB:FROM 3292559 GB:TO 3293581 GB:DIRECTION - GB:PRODUCT polysaccharide biosynthesis protein CapD GB:NOTE PFAM: NAD-dependent epimerase/dehydratase; 3-beta hydroxysteroid dehydrogenase/isomerase; polysaccharide biosynthesis protein CapD; dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal domain; Polysaccharide biosynthesis C-terminal domain protein KEGG: sha:SH0392 capsular polysaccharide synthesis enzyme CapE GB:PROTEIN_ID ABO51536.1 GB:DB_XREF GI:134053565 InterPro:IPR001509 InterPro:IPR002225 InterPro:IPR003869 InterPro:IPR005913 InterPro:IPR013120 InterPro:IPR013692 LENGTH 340 SQ:AASEQ MFKNSTLLITGGTGSFGNAVLNRFLTTDISEIRIFSRDEKKQDDMRKLYKNDKIKFYIGDVRDIASVKNAMHGVNYIFHAAALKQVPSCEFFPLEAVKTNVLGTDNVLTAAIEYGVKKVICLSTDKAAYPINAMGISKAMMEKVLVAKSKTVDPAKTLICCTRYGNVMASRGSVIPLFIDQVKSGQPLTVTDPSMTRFLMSLEEAVELVVFAFQNAQAGDILVQKSPASTIGDLAQAIKELFNVNNEIKIIGTRHGEKLYETLLTKEEYIVAQDLGGFFRVPADKRDLNYDKYFVEGNQKLSSEEEYNSHNTYRLNIEQIKDKLLSLDYVNNELESWSKP GT:EXON 1|1-340:0| BL:SWS:NREP 1 BL:SWS:REP 1->336|CAPD_RICRS|e-118|61.6|336/341| SEG 257->269|eklyetlltkeey| BL:PDB:NREP 1 BL:PDB:REP 1->311|2gn4B|3e-57|39.9|306/327| RP:PDB:NREP 2 RP:PDB:REP 1->132|1ds6B|1e-16|11.9|126/179| RP:PDB:REP 162->323|3d5bZ|2e-22|10.1|159/188| RP:PFM:NREP 2 RP:PFM:REP 7->282|PF02719|2e-54|44.5|274/291|Polysacc_synt_2| RP:PFM:REP 284->330|PF08485|1e-14|63.8|47/48|Polysacc_syn_2C| HM:PFM:NREP 2 HM:PFM:REP 7->281|PF02719|1.5e-108|47.6|275/296|Polysacc_synt_2| HM:PFM:REP 284->330|PF08485|4.3e-25|63.8|47/48|Polysacc_syn_2C| GO:PFM:NREP 3 GO:PFM GO:0009058|"GO:biosynthetic process"|PF02719|IPR003869| GO:PFM GO:0003978|"GO:UDP-glucose 4-epimerase activity"|PF08485|IPR013692| GO:PFM GO:0009103|"GO:lipopolysaccharide biosynthetic process"|PF08485|IPR013692| RP:SCP:NREP 1 RP:SCP:REP 5->243|1xq6A|1e-31|21.7|226/253|c.2.1.2| HM:SCP:REP 1->322|2c5aA1|7.7e-52|29.2|260/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 899 OP:NHOMOORG 577 OP:PATTERN --1-------------1-------12222-1-31111112112-1-321213211221121---1--2 -31-1--111-------------------------------111-1-2---1-121-211--1--1-2--1--------12-1--11-6434-9-----222331322-2--------------1---1211131-11143-----1---111----21-1-1--1-113--111112111111-1--11---311111421-231341-13321124-1-2222------211222222221222212--21------------------1----1---------1--21111121111-------------1--------1-112233333433331144311-32311-12122232131121--11-2----2222-------21133-1121111111111111-2112121121--1---12221211--2121-21111---1111111111111312------------1111111111111-----1-11-133121111111111111121111111112222--2-111-1--21111222111121111111111141223221111-12----3221224211-21--343322222221311111111112111--22-11-2222222--32-11-111321213---23----------11--------------------------------------21--1---------------------1------------------111111111111-2---1-1-----1--2111-1111111111212222222221111211111111-33221111112122111111111111111-11222233--------112-------------------------2132121222--1 ----11-------22--------------------------------------------------------------------------------------------------------------------------------------------------------------2--------1--1237-52--1-1-- -----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 330 STR:RPRED 97.1 SQ:SECSTR cEEcccEEEETTTcTTHHHHHHHHHHTTcccEEEEEccccTTccHHHHHHHTTcEEEEccTTcHHHHHHHHTTccEEEEcccGGGcGHHcGGGGGGccEEEEGGHHHHHHHHHHcccEEEcccccccGGGccccHHHHHHHHHHHHHHcHHHHHHTcccEEccccHHHHHHHTEEEEEEEcTTccEEEEEEHHHHHHHHHHHTTTccEEEEcTTccEEEcccEEEETTETTEEEEEEEEEccEEEEEEEEccccHHHHTTcccEEcccEEcTTcccccEEEcTTcccTTccEEccGGGccccTTEEccccTcEEEEcccccTHHTccccc########## DISOP:02AL 339-341| PSIPRED cccccEEEEEccccHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHccccEEEEEcccccHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccHHHHHHHHHHccccEEEcccccEEEEEEHHHHHHHHHHHHHcccccEEEccccccEEHHHHHHHHHHHHcccccEEEEccccccHHHHHHHccHHHHHHHccccccccccccccccHHHHHHHHHHHccccccccccHHHHHcHHHHHHHHHccHHHHHHHHHcccc //