[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51537.1
DDBJ      :             dTDP-glucose 4,6-dehydratase
Swiss-Prot:             

Homologs  Archaea  66/68 : Bacteria  821/915 : Eukaryota  179/199 : Viruses  3/175   --->[See Alignment]
c.2.1
:362 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->337 2hunB PDBj e-102 54.3 %
:RPS:PDB   4->329 1e7rA PDBj 5e-47 19.0 %
:RPS:SCOP  4->341 1bxkA  c.2.1.2 * e-101 50.3 %
:HMM:SCOP  1->352 1kepA_ c.2.1.2 * 3.7e-93 40.1 %
:RPS:PFM   6->255 PF01370 * Epimerase 2e-43 44.9 %
:HMM:PFM   6->258 PF01370 * Epimerase 1.5e-69 41.6 231/238  
:BLT:SWISS 7->341 RFBB_XANCB e-106 55.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51537.1 GT:GENE ABO51537.1 GT:PRODUCT dTDP-glucose 4,6-dehydratase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3294903..3295991) GB:FROM 3294903 GB:TO 3295991 GB:DIRECTION - GB:PRODUCT dTDP-glucose 4,6-dehydratase GB:NOTE TIGRFAM: dTDP-glucose 4,6-dehydratase PFAM: NAD-dependent epimerase/dehydratase; 3-beta hydroxysteroid dehydrogenase/isomerase; polysaccharide biosynthesis protein CapD; dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal domain KEGG: mth:MTH1789 dTDP-glucose 4,6-dehydratase GB:PROTEIN_ID ABO51537.1 GB:DB_XREF GI:134053566 InterPro:IPR001509 InterPro:IPR002225 InterPro:IPR003869 InterPro:IPR005888 InterPro:IPR005913 InterPro:IPR013120 LENGTH 362 SQ:AASEQ MASKKILVTGGAGFIGSNFVKLILNKYPEYKIINVDLLTYAGNLENLKEVCNKPNYTFIKADIRDREIIDHIFSRYIDSVVNFAAESHVDRSIEEPEVFLTTNVIGTQVLLDTAKKYWKINPNDKYCKEYKHGVKFIQVSTDEVYGSLGAEGMFVETMPLMPNSPYSASKASADMIVRAYHKTYSLPINITRCSNNYGPYQFPEKLIPLIINNCLKGKELPVYGDGMQIRDWLHVSDHCSAIDAVLHKGVDGEVYNVGGNNEKANIEIVKLIIKTLGKSEDLIKYVKDRPGHDRRYAIDSTKITSQLGWKPTYSFEQGMKETIEWYLKNTDWIKNIVSGDYVNFFDKMYSRIIDEVAGEKED GT:EXON 1|1-362:0| BL:SWS:NREP 1 BL:SWS:REP 7->341|RFBB_XANCB|e-106|55.8|328/351| BL:PDB:NREP 1 BL:PDB:REP 1->337|2hunB|e-102|54.3|322/325| RP:PDB:NREP 1 RP:PDB:REP 4->329|1e7rA|5e-47|19.0|290/314| RP:PFM:NREP 1 RP:PFM:REP 6->255|PF01370|2e-43|44.9|227/232|Epimerase| HM:PFM:NREP 1 HM:PFM:REP 6->258|PF01370|1.5e-69|41.6|231/238|Epimerase| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF01370|IPR001509| GO:PFM GO:0044237|"GO:cellular metabolic process"|PF01370|IPR001509| GO:PFM GO:0050662|"GO:coenzyme binding"|PF01370|IPR001509| RP:SCP:NREP 1 RP:SCP:REP 4->341|1bxkA|e-101|50.3|332/341|c.2.1.2| HM:SCP:REP 1->352|1kepA_|3.7e-93|40.1|334/346|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 4608 OP:NHOMOORG 1069 OP:PATTERN 11211-22444345522312134293336533386328152226845969776133322332133-14 66F5622433522224433-33224533333212222325276722111442755311117511665635333333342222846874BBA616111--65666777D75--------------453322753473CCCCC-11B3B87B99A4433754454565986879536556775373331122413544545996648599836554444845223431112117C2111111111111113---1611144233133522433522323223432333433344242243241111111111111322333222232-847776677555914433425181-5214243C868243312122324994459-----55BD67527637E43554554545-BBBGBC984B415776BI7CGDAA52832233978934-4444444453443B86-----------------------------2324214653375545754444558955553437A656432563732342344223436342442233332355574365993AB8A7A977997666C6776777C87443113335532221222225243654757426434153355444333344533244--16335------34444555555555563-5656474354554345546534435345276656555365663555255554-623343323444--3-5455511115252322222222222222342222142337332535682224443655233322333453442222225225343444422233231-B6668899111111112-1----------1-1---13-1-----1133522221685 -222324-52214772212-1213132---111111-1-1111---2111343311112111322-11-2-12-211-1112222233-24222222222221658-5I682434423122233641538G5-332223-214331243241143333546848331335H49758455*E8B54SKOW2UB68A7879 -----------------------3--------------------------------------------------------------------------------------------------------------------------------------------------11--- STR:NPRED 359 STR:RPRED 99.2 SQ:SECSTR TccEEEEEETTTcHHHHHHHHHHTTcTTEEEEccccccTTccGGGTTTTTTcETTcTTTccTTcHHHHHHHHHHHccEEEEcccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHTTccTccETccHHHHHHcEEEEEccGGGccTTccGGGTTcccccGGGHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcEEEcTTcHHHHHHHHHHHHHHTccEEEEEcccccEEcEEEHHHHHHHHHHHHHccHHHHHHTccTTcccEEEcccccEHHHHHTcccEEEEETTccccccccccccHHHHHHTTccccccHHHHHHHHHHHHHHTHHHHHHHHHcGGTTTTccccccHHHEcccc### DISOP:02AL 1-2,358-363| PSIPRED ccccEEEEEccccHHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHccccEEEEEcccccHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEcHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHHcccccEEEEcccccccccHHHHHHHHHHHHHHccccccEEEEcccccEEHHHHHHHHHHHHcccccEEEEccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccc //