[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51545.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:349 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->332 PF01757 * Acyl_transf_3 2.1e-28 20.8 289/340  
:BLT:SWISS 82->211 SKFD_BACSU 3e-05 28.8 %
:BLT:SWISS 145->342 NU4M_CERCA 6e-04 23.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51545.1 GT:GENE ABO51545.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3304070..3305119) GB:FROM 3304070 GB:TO 3305119 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: pin:Ping_1180 hypothetical protein GB:PROTEIN_ID ABO51545.1 GB:DB_XREF GI:134053574 LENGTH 349 SQ:AASEQ MEMIYMEKKMEDNRLTWQLTITSFILSVLIIFHHCFNIDVDYDAIVGQGVYRVAYVIERYMYNISECAVPIFFFISAFLFFKTYKQSVNYYVYKLKKRLFSLLIPYILYNILGYYKYILFNNITFNFNELIVSIISSSTMPLWFIRELMILSILSPLIYWVINRKYVSIIVLGITALLSIFGVASYRCFIYWTSIYLFGAYVAVYYGTFNFFSLRNNKKKIVVPLSCILFLCSAWFLPNTTGDMDIYGELAFYLFRLICPFIMLLLCSYDSSKIQVKFYMRYSFFTYCVHMPLISVVQYVTSRVVFADSWLLIAEYMLTPFVILTIIVCAATLLSKYFPHIWKVCNGWR GT:EXON 1|1-349:0| BL:SWS:NREP 2 BL:SWS:REP 82->211|SKFD_BACSU|3e-05|28.8|125/311| BL:SWS:REP 145->342|NU4M_CERCA|6e-04|23.0|183/100| TM:NTM 10 TM:REGION 15->37| TM:REGION 56->78| TM:REGION 100->122| TM:REGION 142->163| TM:REGION 166->187| TM:REGION 190->212| TM:REGION 221->243| TM:REGION 247->268| TM:REGION 289->311| TM:REGION 321->343| SEG 72->81|fffisaflff| HM:PFM:NREP 1 HM:PFM:REP 25->332|PF01757|2.1e-28|20.8|289/340|Acyl_transf_3| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,6-7| PSIPRED ccEEEEHHHccccEEEEEEEHHHHHHHHHHHHHHHccccccccHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccEEEEccccEEEEEEHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //