[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO51550.1
DDBJ      :             DegT/DnrJ/EryC1/StrS aminotransferase
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  639/915 : Eukaryota  18/199 : Viruses  1/175   --->[See Alignment]
c.67.1
:382 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->365 1o61A PDBj 3e-79 46.5 %
:RPS:PDB   3->366 3dr4C PDBj 5e-62 37.2 %
:RPS:SCOP  16->366 1o61A  c.67.1.4 * e-118 47.4 %
:HMM:SCOP  15->374 1b9hA_ c.67.1.4 * 1.2e-105 38.5 %
:RPS:PFM   18->366 PF01041 * DegT_DnrJ_EryC1 1e-74 43.9 %
:HMM:PFM   18->365 PF01041 * DegT_DnrJ_EryC1 1.2e-100 39.3 346/363  
:BLT:SWISS 1->380 EPSN_BACSU e-108 53.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO51550.1 GT:GENE ABO51550.1 GT:PRODUCT DegT/DnrJ/EryC1/StrS aminotransferase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(3308048..3309196) GB:FROM 3308048 GB:TO 3309196 GB:DIRECTION - GB:PRODUCT DegT/DnrJ/EryC1/StrS aminotransferase GB:NOTE PFAM: DegT/DnrJ/EryC1/StrS aminotransferase KEGG: bca:BCE_5394 aminotransferase family protein GB:PROTEIN_ID ABO51550.1 GB:DB_XREF GI:134053579 InterPro:IPR000653 LENGTH 382 SQ:AASEQ MGDRIYLSSPHMSDEGYEMQYIKEAFDTNWIAPLGKNVNEFENELAAMVGAKSAAALSSGTAAIHLALKAAGVGAGDIVLCQSLTFSATANSIIYQNAIPVFIDSDFETWNMSPVALEKAFEKYPNAKAVLVVHLYGLSADMDKIMEICNEHNAVVIEDAAESLGSYYKGKYTGTFGEYGVFSFNGNKIITTSGGGMLVSHNEEKINKVRFWATQARDQARHYQHSELGFNYRMSNIVAGIGRGQLKVLDQRIAKKKYIFDFYKRELGSLEGVEFMPINEWNEPNYWLSCITLSGQVRPLDIMEALEKENIESRPIWKPMHLQPFFAEYDYIGGDESKKLFENGVCLPSDTKMTDEDLSRVCDVIKGLWVKEKAYKEIASNY GT:EXON 1|1-382:0| BL:SWS:NREP 1 BL:SWS:REP 1->380|EPSN_BACSU|e-108|53.2|378/388| BL:PDB:NREP 1 BL:PDB:REP 16->365|1o61A|3e-79|46.5|344/374| RP:PDB:NREP 1 RP:PDB:REP 3->366|3dr4C|5e-62|37.2|360/368| RP:PFM:NREP 1 RP:PFM:REP 18->366|PF01041|1e-74|43.9|344/358|DegT_DnrJ_EryC1| HM:PFM:NREP 1 HM:PFM:REP 18->365|PF01041|1.2e-100|39.3|346/363|DegT_DnrJ_EryC1| RP:SCP:NREP 1 RP:SCP:REP 16->366|1o61A|e-118|47.4|348/374|c.67.1.4| HM:SCP:REP 15->374|1b9hA_|1.2e-105|38.5|356/0|c.67.1.4|1/1|PLP-dependent transferases| OP:NHOMO 1714 OP:NHOMOORG 694 OP:PATTERN -----1--1-------1311111----2-2--222-1211--112-1414-11111-1-12---1-12 266-5---11----1--22-2---2-21222-----22112334-41-----223-----62316351-5---------231-113419433-711---43445334717--------------23233222344145575---2-4431444122222121214213374422222234122---1-222--422323222-313142--44432332312211------22---------------2--1-------------1-----1-----------------11111111111-----------------------111354445555543--33311--3412-121332334411-1--21---121433311111115424322112322222222221-21221415321-----3425453133222222--222421111111121112A12-----------------------------33-11-333233223222222211234444242243233124326223-1313221241-216311111111-21213325424435665448449538531222-35355531443453131111111441342241-212223113223251222222332143---1212------23232322332222322-32222222323223323322225776232333333332333322211222321233333323333--1-444442222311-31112-21----2--1-1111111311-212125521--222322211111111342111111112-13--23333223------73667779--------211-------------------------2233322222241 -------------1--------1212-------111--------------1---------------------------------------------------------2------------------------------------------------------3--------------3F--2-----1---1----13 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 381 STR:RPRED 99.7 SQ:SECSTR cccccccccccccccHHHHHHHHHHHHHTcccccccHHHHHHHHHHHHHTccEEEEEccHHHHHHHHHHHTTccTTcEEEEEccccTHHHHHHHHTTcEEEEEcccTTTccccHHHHGGGccTTTTEEEEccccGGGccccHHHHHHHHHHTTcEEEEEcTTcTTcEETTEETTccccEEEEEccTTccccccccEEEEEccHHHHHHHHHHHcTTccTTcTTccccccccccccHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHGGGGGGGEEccccTTcccccccEEEEEcTcccHHHHHHHHHHTTcccEEccccGGGcGGGGGGcccccHHHHHHHHHEEEEcccTTccHHHHHHHHHHHHHHTHHHHHHHHTccc# DISOP:02AL 1-2,378-378,380-380,382-383| PSIPRED ccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHcccEEEEEEccHHHccccHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHcccEEEEEcccccccccccccccccccEEEEEccccccccccccEEEEEccHHHHHHHHHHHHcccccccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccccEEEEEEEEcccccHHHHHHHHHHcccEEEEEcccccccHHHHHccccccHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHccccc //