[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV53996.1
DDBJ      :             transcriptional regulator, TrmB
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.122.1
:371 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   94->190 2zkjB PDBj 2e-06 28.9 %
:RPS:PDB   106->195 2btzA PDBj 4e-10 25.6 %
:RPS:PDB   289->364 2d1hB PDBj 1e-07 14.9 %
:RPS:SCOP  40->175 1gjvA2  d.122.1.4 * 2e-11 34.5 %
:RPS:SCOP  314->371 2p8tA1  a.4.5.72 * 1e-07 27.3 %
:HMM:SCOP  50->174 1b3qA3 d.122.1.3 * 1.4e-12 26.4 %
:HMM:SCOP  304->364 1ku9A_ a.4.5.36 * 1.7e-07 29.5 %
:RPS:PFM   79->174 PF02518 * HATPase_c 1e-05 36.8 %
:RPS:PFM   304->358 PF01978 * TrmB 7e-06 34.5 %
:HMM:PFM   77->175 PF02518 * HATPase_c 6.6e-13 29.9 97/111  
:HMM:PFM   305->359 PF01978 * TrmB 2e-09 29.1 55/68  
:BLT:SWISS 94->209 PDK4_MOUSE 2e-06 27.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV53996.1 GT:GENE ACV53996.1 GT:PRODUCT transcriptional regulator, TrmB GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 67..1182 GB:FROM 67 GB:TO 1182 GB:DIRECTION + GB:PRODUCT transcriptional regulator, TrmB GB:NOTE PFAM: ATP-binding region ATPase domain protein; transcriptional regulator TrmB; SMART: ATP-binding region ATPase domain protein; KEGG: hypothetical protein GB:PROTEIN_ID ACV53996.1 GB:DB_XREF GI:257473676 InterPro:IPR001845 InterPro:IPR002831 InterPro:IPR003594 InterPro:IPR004358 LENGTH 371 SQ:AASEQ MDNQIEKADHQDETADENVEPFDYTHVHAVARIALYDDLRSAPRVTEIHPAPTAEFIESLASKIYEQAKNAGGTIPYTVIREVSENFIHARFAEATVSILDEGNTIRFADQGPGIPYKDQAQIPGFTSAVEPMKHYIRGVGSGLPIVKEYLDFSHGTITIEDNLGTGAVVTISLRAGEATDMPPVDQSSALHPASAQPSAMEPAYPMHEAPQQLQQQIPPQQPMQQPAYPAQYGYANPPYPQEAAPARPPYGYEPEPQYAPPRYAQNPYAAGAPYYPQHGAPAHRAQGMDMQAQHAMAPLIPPLSQRERDFLPIFLSEGALGVTDLSRLTGVPQSSTYVALSKLEEAGLIEKTVGQKRILTDLGYHVANSL GT:EXON 1|1-371:0| BL:SWS:NREP 1 BL:SWS:REP 94->209|PDK4_MOUSE|2e-06|27.6|116/412| SEG 210->242|apqqlqqqippqqpmqqpaypaqygyanppypq| BL:PDB:NREP 1 BL:PDB:REP 94->190|2zkjB|2e-06|28.9|97/359| RP:PDB:NREP 2 RP:PDB:REP 106->195|2btzA|4e-10|25.6|82/357| RP:PDB:REP 289->364|2d1hB|1e-07|14.9|74/96| RP:PFM:NREP 2 RP:PFM:REP 79->174|PF02518|1e-05|36.8|95/112|HATPase_c| RP:PFM:REP 304->358|PF01978|7e-06|34.5|55/63|TrmB| HM:PFM:NREP 2 HM:PFM:REP 77->175|PF02518|6.6e-13|29.9|97/111|HATPase_c| HM:PFM:REP 305->359|PF01978|2e-09|29.1|55/68|TrmB| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF02518|IPR003594| RP:SCP:NREP 2 RP:SCP:REP 40->175|1gjvA2|2e-11|34.5|119/165|d.122.1.4| RP:SCP:REP 314->371|2p8tA1|1e-07|27.3|55/67|a.4.5.72| HM:SCP:REP 50->174|1b3qA3|1.4e-12|26.4|125/185|d.122.1.3|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| HM:SCP:REP 304->364|1ku9A_|1.7e-07|29.5|61/151|a.4.5.36|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------11111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 298 STR:RPRED 80.3 SQ:SECSTR ccccTTccTTcEEEEEHHHHHHHHHHHHHHHHHHTcccccEEEEEEEccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTccccccEEEEEEEccccccHHHHHHHTHHGGGGcTcTTTTcccccHHHHHHHHHHHTTcEEEEEEETTTEEEEEEEEcTTTcccccccccHHHHGGGcHTTHHEEEEEccGG#########################################################################HHHHHHTTTTHHHHHHHHTHcccHHHHHHHHHHHHTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEcccEEHHHHHcccEEcc DISOP:02AL 335-356,371-372| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccEEEEEEEcccEEEEEEEccccccHHHHHHcccEEEccccccccccccccHHHHHHHHHHHHccEEEEEEEccccEEEEEEEEcccccccccccccccccHHHHccccccccccccccccccccccccccccccccccHHHcccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccEEEEEEccccccHHHHHHHHcccccccEEEHHHHHHccHHHHHHcHHHHHHHHHHHHHHcc //