[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54000.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:191 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->115 PF05258 * DUF721 1.9e-05 23.8 84/89  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54000.1 GT:GENE ACV54000.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 5609..6184 GB:FROM 5609 GB:TO 6184 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54000.1 GB:DB_XREF GI:257473680 LENGTH 191 SQ:AASEQ MRKLGESINELMAALAAGDDASRKAQRAAAVNVAWRNAVEAVYKDAAQMVLDHVNAVYIMAADEVVKGATTKASHTGTGAQLVVYADDSLIRSDLDARQEFLKMKLKEQGEHVETFKILPSRFEMKARHPFRRAEEDGAVERAARASREETPRTPLSPEEEAALEASVGAVESPTVRRALERAIRADKNRI GT:EXON 1|1-191:0| SEG 25->42|aqraaavnvawrnaveav| SEG 141->150|eraarasree| SEG 155->167|plspeeeaaleas| HM:PFM:NREP 1 HM:PFM:REP 7->115|PF05258|1.9e-05|23.8|84/89|DUF721| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-26,31-32,34-34,39-40,45-46,48-48,53-53,67-67,81-81,95-95,101-102,104-104,109-109,115-115,118-118,151-152,157-158,160-160,165-165,191-192| PSIPRED ccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEHHHHHHcccccccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHccccHHEEcccHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccc //