[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54003.1
DDBJ      :             multi antimicrobial extrusion protein MatE
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  128/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:555 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   276->425 PF01554 * MatE 4e-06 24.7 %
:HMM:PFM   50->207 PF01554 * MatE 1.4e-19 21.7 157/162  
:HMM:PFM   276->436 PF01554 * MatE 1.9e-23 22.4 161/162  
:HMM:PFM   8->43 PF03263 * Cucumo_2B 0.0004 30.6 36/103  
:BLT:SWISS 24->460 YISQ_BACSU 5e-53 27.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54003.1 GT:GENE ACV54003.1 GT:PRODUCT multi antimicrobial extrusion protein MatE GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 11586..13253 GB:FROM 11586 GB:TO 13253 GB:DIRECTION + GB:PRODUCT multi antimicrobial extrusion protein MatE GB:NOTE PFAM: multi antimicrobial extrusion protein MatE; KEGG: bha:BH2936 hypothetical protein GB:PROTEIN_ID ACV54003.1 GB:DB_XREF GI:257473683 InterPro:IPR002528 LENGTH 555 SQ:AASEQ MYRAAAAQAARLSSKARGAAKRAQTTRRERALRSPAEKTTAGDVFVLSVPLFVELFMQIMIGNINQFMLAPLGTEPAAAVGNALQILNIVTIALSAMGTASTVLVTRVLGKSSATSKVSEIATVALVVNVALAAAMTAVLFLFWPQFFSWLHIDGSITGMASSFLLIVGSTTVVQGAFFAFTALLRSYARGADVMRASLAMNAVNIAASAVLIGGVAFVPAFGVEGAAVANVVARVAGLAVACRLVLRHTDVRMRLAYLRPFPWKTLRRMLGVGIPSSGEQMNYDLAQIVILSFINVLGTTVVTVKVYCSMIAGIAYLYSIALSQATQIVLGYLFGAGKFDAVARRVWVADLIAVALTTCVSTLIWINADAVFGLFTADPMVHELGRQVLLVEIFLGIGRALNIVMVKALIAVGDVKTPVTVNVISSWIFAVAGGYALGIGLGWGIVGMWVAMCVDEWLRAGFLLVTFARGGWRRRAQERRPEPRLETPPDAVETPAVSYAKPSMFVLKKPSATGRPKEPGAVSLSAIMGLALADDGGLTHGIVQAVIDALTALW GT:EXON 1|1-555:0| BL:SWS:NREP 1 BL:SWS:REP 24->460|YISQ_BACSU|5e-53|27.9|434/455| TM:NTM 12 TM:REGION 40->62| TM:REGION 83->105| TM:REGION 121->143| TM:REGION 162->184| TM:REGION 196->218| TM:REGION 226->248| TM:REGION 283->305| TM:REGION 312->334| TM:REGION 354->376| TM:REGION 390->412| TM:REGION 421->443| TM:REGION 450->472| SEG 4->10|aaaaqaa| SEG 122->140|atvalvvnvalaaamtavl| SEG 223->248|gvegaavanvvarvaglavacrlvlr| SEG 433->446|aggyalgiglgwgi| SEG 469->490|arggwrrraqerrpeprletpp| RP:PFM:NREP 1 RP:PFM:REP 276->425|PF01554|4e-06|24.7|150/161|MatE| HM:PFM:NREP 3 HM:PFM:REP 50->207|PF01554|1.4e-19|21.7|157/162|MatE| HM:PFM:REP 276->436|PF01554|1.9e-23|22.4|161/162|MatE| HM:PFM:REP 8->43|PF03263|0.0004|30.6|36/103|Cucumo_2B| GO:PFM:NREP 5 GO:PFM GO:0006855|"GO:drug transmembrane transport"|PF01554|IPR002528| GO:PFM GO:0015238|"GO:drug transmembrane transporter activity"|PF01554|IPR002528| GO:PFM GO:0015297|"GO:antiporter activity"|PF01554|IPR002528| GO:PFM GO:0016020|"GO:membrane"|PF01554|IPR002528| GO:PFM GO:0055085|"GO:transmembrane transport"|PF01554|IPR002528| OP:NHOMO 143 OP:NHOMOORG 132 OP:PATTERN ----1------------------------1-----------------------------11------- --------------------------------------------------------------------------------1---1---22-1-1-------------1------------------------------------------------------------------------------------11111111112111111-111111121111-11111111-5----------------1-----------------------------111-111--------------1----1--------11111111--121--------1-1----1---111--121-------11---112--1---------------1-----------------------------------111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1111111111----------------111---------1111-1-1111-1--1---------------------------------------------------------111-----------------------------------------------------1----------------------------1----------------------------11------11-11------------------11---------------------------------------------1-111-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 555-556| PSIPRED cccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccccccHHHcccHHHHHccccccccccccccEEHHHHHHHHHHccccHHHHHHHHHHHHHHHcc //