[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54033.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:213 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->34 PF07784 * DUF1622 0.00096 35.5 31/77  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54033.1 GT:GENE ACV54033.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 54097..54738 GB:FROM 54097 GB:TO 54738 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54033.1 GB:DB_XREF GI:257473713 LENGTH 213 SQ:AASEQ MTKARNILRDTSGASIVIALVFFLICGIIGSVVMTAASVQAKAAQTHVDLQQKEYAMQSAAKLMAQQLGGEDAVWEEKSVVVKIAYDTAGEASVDTNSLRSMIGQSFWTERRTKDILAARAEGKDYVLGSSASNRLLIDPPSEAGGLAPVYGCITVDPDLNITVELSLDSAFAADSPYNTTISIQCTPTFDSQGRVTVIEYGDNTTVKKTEAA GT:EXON 1|1-213:0| TM:NTM 1 TM:REGION 15->37| HM:PFM:NREP 1 HM:PFM:REP 4->34|PF07784|0.00096|35.5|31/77|DUF1622| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-25,53-53,59-60,62-62,66-68,73-74,76-76,81-81,109-109,115-116,118-118,123-124,129-129,132-132,165-165,171-171,179-180,185-186,188-188,193-193| PSIPRED ccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccccEEEEcccccccccccEEEEEEEccccEEEEEEEEccccccccccccEEEEEEcccccccccEEEEEEccccEEEEcccc //